Copy Link Print Information

IL-17A Protein, Human (HEK293, His)

12 Cited Publications
Customer Review

Based on 12 publication(s) in Google Scholar

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases. IL-17A Protein, Human (HEK293, His) is a recombinant human IL-17A protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 132 amino acids (G24-A155).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • IL-17A Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Human (HEK293, His) is a recombinant human IL-17A protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 132 amino acids (G24-A155).

Background

Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4+ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8+ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils[1][2][3].
The human IL-17A shares 63.23% amino acid sequence identity with mouse and 61.90% identity with rat.
IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6[1][2].
IL-17A can be used for the research of autoimmune diseases, infection and cancer[1][4].

In Vitro

IL-17A (100 ng/mL; 24 h) inhibits the expression of thymic stromal lymphopoietin (TSLP) in human primary keratinocytes[5].
IL-17A (0.1–100 ng/mL; 0-24 h) significantly potentiates TNF-α-induced IL-8 protein secretion and gene expression in a concentration- and time-dependent manner[6].

Verified Bioactivity

1.Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells and the ED50 for this effect is 1-10 ng/mL.
2.Loaded IL-17A (HEK293, His) on NTA biosensor, can bind Sonelokimab (HY-P99397) with an affinity constant of <1.000E-11 M as determined in BLI assay.
3.Loaded Bimekizumab (HY-P99280) on AHC2 biosensor, can bind IL-17A Protein, Human (HEK293, His) with an affinity constant of <1.000E11 M as determined in BLI assay.
4.Loaded Lecankitug (HY-P991146) on ProA biosensor, can bind IL-17A Protein, Human (HEK293, His) with an affinity constant of 3.464E-10 M as determined in BLI assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 3.295 ng/mL, corresponding to a specific activity is 3.03×105 U/mg.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded IL-17A (HEK293, His) on NTA biosensor, can bind Sonelokimab (HY-P99397) with an affinity constant of <1.000E-11 M as determined in BLI assay.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Bimekizumab (HY-P99280) on AHC2 biosensor, can bind IL-17A Protein, Human (HEK293, His) with an affinity constant of <1.000E11 M as determined in BLI assay.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Lecankitug (HY-P991146) on ProA biosensor, can bind IL-17A Protein, Human (HEK293, His) with an affinity constant of 3.464E-10 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q16552 (G24-A155)

  • Gene ID
    3605  [NCBI]
  • Molecular Construction
    • N-term
    • IL-17A (G24-A155)
      Accession # Q16552
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc

  • AA Sequence

    GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

  • Predicted Molecular Mass

    15.9 kDa

  • Molecular Weight

    Approximately 15-22 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Chen K, et al. Interluekin-17A (IL17A). Gene. 2017 May 30;614:8-14. [Content Brief]

[2]. Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79. [Content Brief]

[3]. Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10(7):479-89. [Content Brief]

[4]. Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181(4):2799-805. [Content Brief]

[5]. Kinoshita H, et al. Cytokine milieu modulates release of thymic stromal lymphopoietin from human keratinocytes stimulated with double-stranded RNA. J Allergy Clin Immunol. 2009 Jan;123(1):179-86. [Content Brief]

[6]. Henness S, et al. IL-17A acts via p38 MAPK to increase stability of TNF-alpha-induced IL-8 mRNA in human ASM. Am J Physiol Lung Cell Mol Physiol. 2006 Jun;290(6):L1283-90. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 3.295 ng/mL, corresponding to a specific activity is 3.03×105 U/mg.

  • 1/16

    MedChemExpress Validation
     Loaded IL-17A (HEK293, His) on NTA biosensor, can bind Sonelokimab (HY-P99397) with an affinity constant of <1.000E-11 M as determined in BLI assay.

  • 1/16

    MedChemExpress Validation
     Loaded Bimekizumab (HY-P99280) on AHC2 biosensor, can bind IL-17A Protein, Human (HEK293, His) with an affinity constant of <1.000E11 M as determined in BLI assay.

  • 1/16

    MedChemExpress Validation
     Loaded Lecankitug (HY-P991146) on ProA biosensor, can bind IL-17A Protein, Human (HEK293, His) with an affinity constant of 3.464E-10 M as determined in BLI assay.

  • 1/16

    IL-17A Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: J Neuroinflammation. 2025 Nov 14;22(1):268. [Abstract]

    Customer Validation
     The protein levels of activated astrocyte markers GFAP and S100B in human astrocyte SVG P12 cells treated with IL-17A recombinant protein (100 ng/mL, 24 h) alone or in combination with an anti-IL-17RA.

  • 1/16

    IL-17A Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: J Neuroinflammation. 2025 Nov 14;22(1):268. [Abstract]

    Customer Validation
     The mRNA levels of activated astrocyte markers GFAP and S100B in human astrocyte SVG P12 cells treated with IL-17A recombinant protein (100 ng/mL, 24 h) alone or in combination with an anti-IL-17RA.

  • 1/16

    IL-17A Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: J Neuroinflammation. 2025 Nov 14;22(1):268. [Abstract]

    Customer Validation
     The A1 astroyte marker (C3, FbIn5, Ligp1, and Serping1) and A2 astrocyte marker (Clcf1, Tgm1, Cd109, Ptx3, and S100A10) in human astrocyte SVG P12 cells (n=3), cells were treated with IL-17A recombinant protein (100 ng/mL, 24 h) alone or in combination with an anti-IL-17RA.

  • 1/16

    IL-17A Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: J Neuroinflammation. 2025 Nov 14;22(1):268. [Abstract]

    Customer Validation
     Western blot analysis showed the expression of NF-κB pathways changes in SVG P12 cells treated with IL-17 A recombinant protein (100 ng/mL, 24 h) or in combination with an anti-IL-17RA.

  • 1/16

    IL-17A Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: J Neuroinflammation. 2025 Nov 14;22(1):268. [Abstract]

    Customer Validation
     Western blot analysis showed the expression of MAPK pathways changes in SVG P12 cells treated with IL-17 A recombinant protein (100 ng/mL, 24 h) or in combination with an anti-IL-17RA.

  • IL-17A Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Human (HEK293, His)
  • IL-17A Protein, Human (HEK293, His) Product Image