1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17A
  6. IL-17A Protein, Mouse (HEK293, His)

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases. IL-17A Protein, Mouse (HEK293, His) is a recombinant mouse IL-17A protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 137 amino acids (T22-A158).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
In Vivo Efficacy Study
Histological Imaging/Staining
Bio/Physico-chemical Assay
IF
RT-PCR

    IL-17A Protein, Mouse (HEK293, His) purchased from MCE. Usage Cited in: Brain Behav Immun. 2025 Dec 9:132:106218.  [Abstract]

    IL-17A Protein, Mouse (HEK293, His) (100 ng; i.c.) markedly exacerbated chronic pruritus in IMQ-treated mice.

    IL-17A Protein, Mouse (HEK293, His) purchased from MCE. Usage Cited in: Brain Behav Immun. 2025 Dec 9:132:106218.  [Abstract]

    IL-17A Protein, Mouse (HEK293, His) (100 ng; i.c.) intensified IMQ-induced pathological alterations in C57BL/6J mice.

    IL-17A Protein, Mouse (HEK293, His) purchased from MCE. Usage Cited in: Brain Behav Immun. 2025 Dec 9:132:106218.  [Abstract]

    IL-17A Protein, Mouse (HEK293, His) (100 ng/mL; 12 h) markedly enhanced IL-6 mRNA levels and extracellular IL-6 protein secretion in the DRG neurons.

    IL-17A Protein, Mouse (HEK293, His) purchased from MCE. Usage Cited in: Brain Behav Immun. 2025 Dec 9:132:106218.  [Abstract]

    The IL-6 expression in DRG neurons of IMQ-induced psoriatic mice injected with IL-17A Protein, Mouse (HEK293, His) (100 ng; i.c.) was detected by immunofluorescent staining.

    IL-17A Protein, Mouse (HEK293, His) purchased from MCE. Usage Cited in: Brain Behav Immun. 2025 Dec 9:132:106218.  [Abstract]

    IL-17A Protein, Mouse (HEK293, His) (100 ng; i.c.) promoted the mRNA level of IL-6 in DRG tissues of IMQ-induced psoriasis model mice.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Mouse (HEK293, His) is a recombinant mouse IL-17A protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 137 amino acids (T22-A158).

    Background

    Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4+ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8+ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils[1][2][3].
    The mouse IL-17A shares 63.23% amino acid sequence identity with human and 87.33% identity with rat.
    IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6[1][2].
    IL-17A can be used for the research of autoimmune diseases, infection and cancer[1][4].

    In Vivo

    Recombinant mouse interleukin 17 (rmIL-17) (0.1 or 0.9 μg/rat/day; nasally; 6 days) shows increased infiltration of inflammatory cells into the sciatic nerve, more severe demyelination, augmented proliferation of regional lymph node cells, and increased serum levels of tumor necrosis factor-α in chronic experimental autoimmune neuritis (EAN) induced Lewis rats[5].
    rmIL-17A (625 ng/mouse; i.t.; once) dramatically synergizes TNF-alpha induced neutrophil accumulation in C57BL/6 mice[6].

    Biological Activity

    Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.25-2.495 ng/mL, corresponding to a specific activity is 4.01×105 - 4×106 U/mg.

    • Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2.495 ng/mL, corresponding to a specific activity is 4.01×105 U/mg.
    Species

    Mouse

    Source

    HEK293

    Tag

    C-6*His

    Accession

    Q62386 (T22-A158)

    Gene ID
    Molecular Construction
    N-term
    IL-17A (T22-A158)
    Accession # Q62386
    6*His
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17
    AA Sequence

    TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

    Predicted Molecular Mass
    16.2 kDa
    Molecular Weight

    Approximately 17-26 kDa, based on SDS-PAGE under reducing conditions.

    Glycosylation
    Yes
    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    IL-17A Protein, Mouse (HEK293, His) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    IL-17A Protein, Mouse (HEK293, His)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IL-17A Protein, Mouse (HEK293, His)
    Cat. No.:
    HY-P70753
    Quantity:
    MCE Japan Authorized Agent: