1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. IL-8/CXCL8
  6. IL-8/CXCL8 Protein, Human

Interleukin-8 (IL-8), also known as CXCL8 or NAP-1, is a pro-inflammatory CXC chemokine. IL-8 acts on human neutrophils via two receptors, CXCR1 and CXCR2. IL-8 has a conserved Glu-Leu-Arg (ELR) N-terminal motif, and is an agonist for CXCR1/CXCR2. IL-8 is produced by various cells including leukocytes, endothelial cells, and epithelial cells. IL-8/CXCL8 Protein, Human is produced in E.coil.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
> 500 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

    IL-8/CXCL8 Protein, Human purchased from MCE. Usage Cited in: J Biomed Sci. 2025 Jan 6;32(1):5.  [Abstract]

    Western blot was performed to evaluate the expression of EMT marker in SW480 and HT29 cells after treated with IL-8, F. nucleatum and Reparixin.

    IL-8/CXCL8 Protein, Human purchased from MCE. Usage Cited in: Cancer Cell Int. 2021 Jul 3;21(1):337.  [Abstract]

    The clones were dramatically inhibited by Danirixin or Reparixin, while exogenous CXCL8 significantly enhanced the colony formation of PC9GR.

    IL-8/CXCL8 Protein, Human purchased from MCE. Usage Cited in: Cancer Cell Int. 2021 Jul 3;21(1):337.  [Abstract]

    The percentage of CSCs was reduced in the setting of CXCL8-CXCR1/2 loop blockage, and recombinant CXCL8 could reverse the CSCs proportion.

    IL-8/CXCL8 Protein, Human purchased from MCE. Usage Cited in: J Cell Mol Med. 2020 Jan;24(2):1588-1598.  [Abstract]

    The effects of IL-8 (100 ng/mL; 48 h) on the migration ability of ovarian cancer cells illustrated by the monolayer wound healing assay.

    IL-8/CXCL8 Protein, Human purchased from MCE. Usage Cited in: J Cell Mol Med. 2020 Jan;24(2):1588-1598.  [Abstract]

    IL-8 promote the cilia formation of SKOV3 cells and A2780 cells. The images showed the cytoskeleton (red) and nucleus (blue).

    IL-8/CXCL8 Protein, Human purchased from MCE. Usage Cited in: J Cell Mol Med. 2020 Jan;24(2):1588-1598.  [Abstract]

    The effects of IL-8 on the migration ability of ovarian cancer cells illustrated by the Transwell assay. Typical optical images of SKOV3 and A2780 illustrated cell migration at 24 h. The cells crossed through the pores of Transwell chamber were stained by crystal violet, Scale bars = 100 μm.
    • Biological Activity

    • Technical Parameters

    • Properties

    • 제품 설명

    • References

    제품 설명

    Interleukin-8 (IL-8), also known as CXCL8 or NAP-1, is a pro-inflammatory CXC chemokine. IL-8 acts on human neutrophils via two receptors, CXCR1 and CXCR2. IL-8 has a conserved Glu-Leu-Arg (ELR) N-terminal motif, and is an agonist for CXCR1/CXCR2. IL-8 is produced by various cells including leukocytes, endothelial cells, and epithelial cells[1][2][3]. IL-8/CXCL8 Protein, Human is produced in E.coil.

    Background

    IL-8 (CXCL8) belongs to the ELR+ CXC chemokines family. IL-8 is initially produced as a protein of 99 amino acids that undergoes cleavage to form active IL-8 isoforms, a 77 amino acid peptide in non-immune cells or a 72 amino acid peptide in monocytes and macrophages. The gene encoding IL-8 is located on chromosome 4q13-q21. Dimerisation of IL-8 forms the structural basis for receptor binding. IL-8 is expressed by various cells including monocytes, macrophages, leukocytes, endothelial cells, and epithelial cells[1][2][3].
    Mature human IL-8/CXCL8 shares 75% amino acid sequence identity with canine IL-8/CXCL8. While, human IL-8 shares 94.95% aa sequence identity with Rhesus Macaque IL-8 protein.
    IL-8 is responsible for the recruitment and activation of neutrophils and granulocytes to the site of inflammation. IL-8 is almost undetectable in physiological states, but is rapidly induced by pro-inflammatory cytokines such as TNFα and IL-1β. The function of IL-8 mainly relies on its interaction with specific cell surface GPCR, CXCR1 and CXCR2. In addition, IL-8 is reported to promote integrin β3 upregulation and the invasion of hepatocellular carcinoma cells through activation of the PI3K/Akt pathway. In odontogenic lesions, IL-8 has been proven to be highly expressed in ameloblastoma epithelial cells and irreversible pulpitis. In rheumatoid arthritis and other inflammatory joint diseases IL-8 could bring about the accumulation of neutrophils, which are considered a major source of cartilage-degrading enzymes. IL-8 stimulates the MAPK and tyrosine phosphorylation of cellular proteins. Tumour cells and fibroblasts communicate with each other, including autocrine and paracrine factors, including IL-8, resulting in the upregulation of MMP2 and MMP9 degradable extracellular matrix (ECM) components that trigger tumour invasion[1][2][3][4].
      IL-8 is typically known to promote angiogenesis, but it also activates matrix metalloproteinase (MMP) that is involved in metastasisrelated tissue remodelling. IL-8 is induced in lipopolysaccharide (LPS)-stimulated monocytes and shown to induce neutrophil migration. IL-8 exerts multiple effects on biological activities of tumour cells including proliferation, invasion and migration. IL-8 also increases the expression of Akt in androgen-independent prostate cancer (AIPC) cell lines. IL-8 activates MAPK signalling via PI3K in neutrophils, and via transactivation of EGFR resulting in Ras-GTPase activation in ovarian and lung cancer cell lines. There is substantial amount of experimental data suggesting that IL-8 and receptors contribute to elimination of pathogens, but may also contribute significantly to disease-associated processes, including tissue injury, fibrosis, angiogenesis and tumorigenesis[3][5].

    In Vitro

    Recombinant human IL-8/CXCL8 (100 ng/mL; for 24-96 h) stimulation leads to enhancement of invasion and suppression of late stage apoptosis in MG-63 cells. Moreover, secretions of MMPs by MG-63 cells are also increased upon stimulation. CXCL8 induces the elevations of phosphorylated PI3K and Akt, but not PKC or FAK[6].

    In Vivo

    Recombinant human IL-8 (10, 30, and 100 μg/kg; single intravenous injection) injected into rhesus monkeys (2-3 years; 2.5-4.5 kg). IL-8 injection results in instant neutropenia that was due to pulmonary sequestration. Within 30 minutes after IL-8 injection, neutrophilia developed with counts up to 10-fold greater than baseline levels. The numbers of hematopoietic progenitor cells (HPCs) increased of blood at 30 minutes after injection of 100 μg/kg IL-8[7].

    Biological Activity

    1.The ED50 is <150 ng/mL as measured by CHO-K1/Gα15/hCXCR1 cells (human Gα15 and human CXCR1 stably expressed in CHO-K1 cells).
    2.Immobilized Human IL-8 at 2 μg/mL (100 μL/well) can bind Anti-IL-8 Antibody. The ED50 for this effect is 20-50 ng/mL.
    3. Loaded Eltrekibart (HY-P990737) on AHC2 biosensor, can bind IL-8/CXCL8 Protein, Human with an affinity constant of <1.000E-11 M as determined in BLI assay.

    • Immobilized Human IL-8 at 2 μg/mL (100 μL/well) can bind Anti-IL-8 Antibody. The ED50 for this effect is 25.14 ng/mL.
    • Loaded Eltrekibart (HY-P990737) on AHC2 biosensor, can bind IL-8/CXCL8 Protein, Human with an affinity constant of <1.000E-11 M as determined in BLI assay.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P10145 (A23-S99)

    Gene ID
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rHuIL-8/CXCL8; C-X-C motif chemokine 8; Emoctakin; MDNCF; NAP-1; IL8
    AA Sequence

    AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

    Predicted Molecular Mass
    8.9 kDa
    분자량

    Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    선적

    Room temperature in continental US; may vary elsewhere.

    각종 서류
    References

    IL-8/CXCL8 Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    최근 본 상품:

    온라인 문의

    Your information is safe with us. * Required Fields.

    IL-8/CXCL8 Protein, Human

     

    Requested Quantity *

    고객명 *

     

    호칭

    메일주소 *

     

    전화번호 *

    Department

     

    회사명 *

    City

    Country or Region *

         

    비고

    대량구매 문의

    Inquiry Information

    상품명:
    IL-8/CXCL8 Protein, Human
    Cat. No.:
    HY-P7224
    수량:
    MCE Japan Authorized Agent: