1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-AA
  6. PDGF-AA Protein, Human

PDGF-A protein is a key growth factor that regulates embryonic development, cell proliferation, migration, survival, and chemotaxis, and exerts potent mitogenic effects on mesenchymal cells. It is essential for alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, and oligodendrocyte development, and contributes to spinal cord and cerebellar myelination. PDGF-AA Protein, Human is the recombinant human-derived PDGF-AA protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

2 Publications Citing Use of MCE PDGF-AA Protein, Human

Cell Proliferation/Viability Assay
Cell Migration/Invasion Assay
WB
Cell Imaging/Staining

    PDGF-AA Protein, Human purchased from MCE. Usage Cited in: Research Square Preprint. 2022 Feb.

    Pretreatment with PDGF-AA Protein, Human (25 ng/ml) stimulated growth of HUVECs.

    PDGF-AA Protein, Human purchased from MCE. Usage Cited in: Research Square Preprint. 2022 Feb.

    PDGF-AA Protein, Human (25 ng/ml) stimulation increased HUVEC migration to the lower chamber.

    PDGF-AA Protein, Human purchased from MCE. Usage Cited in: Research Square Preprint. 2022 Feb.

    PDGF-AA Protein, Human (25 ng/ml) induced activation of PDGFRα in HUVECs.

    PDGF-AA Protein, Human purchased from MCE. Usage Cited in: Research Square Preprint. 2022 Feb.

    PDGF-AA Protein, Human (25 ng/ml) induced colony formation of HUVECs.

    PDGF-AA Protein, Human purchased from MCE. Usage Cited in: Research Square Preprint. 2022 Feb.

    PDGF-AA Protein, Human (25 ng/ml) increased tube formation in HUVECs.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    PDGF-A protein is a key growth factor that regulates embryonic development, cell proliferation, migration, survival, and chemotaxis, and exerts potent mitogenic effects on mesenchymal cells. It is essential for alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, and oligodendrocyte development, and contributes to spinal cord and cerebellar myelination. PDGF-AA Protein, Human is the recombinant human-derived PDGF-AA protein, expressed by E. coli , with tag free.

    Background

    PDGF-A Protein takes center stage as a pivotal growth factor regulating embryonic development, cell proliferation, migration, survival, and chemotaxis. Acknowledged for its potent mitogenic effects on mesenchymal cells, PDGF-A is indispensable for various developmental processes, including the formation of lung alveolar septa, gastrointestinal tract development, Leydig cell maturation, spermatogenesis, and the normal development of oligodendrocytes, contributing to myelination in the spinal cord and cerebellum. Furthermore, PDGF-A assumes a crucial role in wound healing dynamics. The intricacies of its signaling pathway involve modulation through the formation of heterodimers with PDGFB, demonstrating its regulatory versatility. Structurally, PDGF-A adopts a homodimeric configuration with an antiparallel disulfide-linked dimer, and it forms heterodimers with PDGFB, engaging in interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB. Additionally, PDGF-A exhibits an interaction with CSPG4, adding another layer to its multifaceted involvement in cellular processes.

    Biological Activity

    Measured in a cell proliferation assay using Balb/c 3T3 mouse fibroblast cells. The  ED50 for this effect is <20 ng/mL.

    • Measured in a cell proliferation assay using Balb/c 3T3 mouse fibroblast cells. The ED50 for this effect is 7.548 ng/mL, corresponding to a specific activity is 1.324×105units/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P04085-1 (S87-T211)

    Gene ID
    Molecular Construction
    N-term
    PDGF-AA (S87-T211)
    Accession # P04085-1
    C-term
    Protein Length

    Full Length of Isoform-1 Mature Protein

    Synonyms
    PDGFAA; PDGF-AA
    AA Sequence

    SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

    Predicted Molecular Mass
    14.3 kDa
    Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM Glycine-HCl, 6% sucrose, 4% mannitol, 0.02% Tween 80, pH 3.0.
    2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
    3.Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 20% Acetonitrile, pH 2.5.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    PDGF-AA Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    PDGF-AA Protein, Human

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    PDGF-AA Protein, Human
    Cat. No.:
    HY-P70598
    Quantity:
    MCE Japan Authorized Agent: