PTH Protein, Human

Customer Review

Based on 1 Customer Validation

PTH Protein, Human is a major regulator of mineral ion metabolism.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

PTH Protein, Human is a major regulator of mineral ion metabolism.

Background

Recombinant Human Parathyroid Hormone is a replica of the endogenous Parathyroid hormone molecule. Parathyroid Hormone regulates calcium and phosphorus levels by acting on the bone, kidneys and intestines. In the bone, Parathyroid hormone mobilizes calcium and phosphorus into the circulation by stimulating bone resorption. Parathyroid hormone stimulates osteoblasts to increase the expression of receptor activator of nuclear factor j-B ligand (RANKL)[1].

Verified Bioactivity

1.PTH is fully biologically active when compared to standards. The activity calculated by UMR106 cell/cAMP method corresponding to a specifc activity of 1.0×104 U/mg.
2.Measured by its ability to induce cAMP accumulation in MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is < 60 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PTH (S32-Q115)
      Accession # P01270
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PTH; Preproparathyroid Hormone; Parathyroid Hormone; Parathyroid Hormone 1; Parathormone; Prepro-PTH; Parathyrin; FIH1; PTH1

  • AA Sequence

    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

  • Molecular Weight

    Approximately 9-15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM HAc-NaAc, 150 mM NaCl, 5% mannitol, pH 4.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00