GIP, human TFA
Based on 2 publication(s) in Google Scholar
GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza: 99.15%
- Fòrmula: C226H338N60O66S.xC2HF3O2
- Peso molecular:4983.53 (free base)
-
Almacenamiento:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications Citing Use of MedChemExpress (MCE) GIP, human TFA
More-
Histological Imaging/Staining
-
ELISA
-
Cell Proliferation/Viability Assay
-
Flow Cytometry
-
IF
Actividad biológica
Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state[1]. GIP, human plays a vital role in lipid metabolism and the development of obesity.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Peso molecular 4983.53 (free base)
-
Fòrmula C226H338N60O66S.xC2HF3O2
-
Color White to off-white
-
Synonyms
Gastric Inhibitory Peptide (GIP), human TFA
-
Sequence
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
-
Sequence Shortening
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Toxins
Deoxynivalenol (Vomitoxin)-Induced Anorexia Is Induced by the Release of Intestinal Hormones in Mice. [Abstract]2021 Jul 22;13(8):512. PMID: 34437383 -
Gynecol Endocrinol
Glucose-dependent insulinotropic peptide (GIP) suppresses androgen biosynthesis in PCOS mouse models and cellular systems. [Abstract]2025 Dec 31;41(1):2582506. PMID: 41249890
GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]
GIP (0.1 mg/kg, a single subcutaneous injection) inhibited large cystic follicles and fewer granular cell layers in DHEA (50 mg/kg, subcutaneous injection for 21 days) induced-PCOS C57BL/6J mice (Left: Normal control; Middle: PCOS model (vehicle); Right: PCOS model + GIP).
GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]
GIP( 0.1 mg/kg,a single subcutaneous injection) reduced the serum testosterone concentration in DHEA (50 mg/kg,subcutaneous injection for 21 days)induced-PCOS C57BL/6J mice.
GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]
GIP (10-7 and 10-9 M, 6, 12, and 24 h) had no effect on growth in NCI-H295R cells.
GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]
GIP (10-9 M, 24 h) did not induce apoptosis in NCI-H295R cells.
GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]
GIP (10-9 M, 24 h) downregulated GIPR expression in NCI-H295R cells.
Solvente y solubilidad
DMSO : ≥ 100 mg/mL
H2O : 10 mg/mL (Need ultrasonic)
* "≥" means soluble, but saturation unknown.
Pureza y Documentación
-
Ficha de datos (287 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
[1]. Meier JJ, et al. Gastric inhibitory polypeptide: the neglected incretin revisited. Regul Pept. 2002 Jul 15;107(1-3):1-13. [Content Brief]
[2]. Miyachi A, et al. Quantitative analytical method for determining the levels of gastric inhibitory polypeptides GIP1-42 and GIP3-42 in human plasma using LC-MS/MS/MS. J Proteome Res. 2013;12(6):2690-2699. [Content Brief]
[3]. Gabe MBN, et al. Molecular interactions of full-length and truncated GIP peptides with the GIP receptor - A comprehensive review. Peptides. 2020;125:170224. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)