country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P11235

Copy Link Print Information

Berobenatide

(Synonyms: PF-08653944; MET-097)

Berobenatide (PF-08653944; MET-097) is a GLP-1R agonist that exerts functional regulation of GLP-1R biased toward the Gs protein signaling pathway. Berobenatide induces weight loss in diet-induced obese mice. Berobenatide can be used in obesity-related research.

For research use only. We do not sell to patients.

CAS No.: 3028974-74-2
Formula: C₂₃₂H₃₆₉N₅₇O₆₈
Molecular Weight:5044.75

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Berobenatide Chemical Structure

CAS No.: 3028974-74-2

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- Description
- IC₅₀ & Target
- In Vivo
Chemical Information
Purity & Documentation
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

Description

IC₅₀ & Target^[1]

GLP-1

In Vivo

Berobenatide (0.24-0.8 nmol/kg; subcutaneous injection; once daily; administered for 22 days, with double doses on day 7 and day 14) induces a significantly greater body weight loss in DIO mice than Semaglutide (HY-114118) and Tirzepatide (HY-P1731)^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:

Diet-Induced Obese (DIO)^[1]
Dosage:

0.24 nmol/kg; 0.8 nmol/kg
Administration:

s.c.; daily; 22 days, with dose doubled on day 7 and day 14
Result:

Produced a body weight change of approximately -28% by day 22 at 0.8 nmol/kg final dose.
Induced body weight loss equivalent to that of equimolar doses of Semaglutide and Tirzepatide at 0.24 nmol/kg final dose.

Chemical Information

CAS No. 3028974-74-2
Molecular Weight 5044.75
Formula C₂₃₂H₃₆₉N₅₇O₆₈
Synonyms

PF-08653944; MET-097
Sequence

Phe-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Leu-Glu-Glu-Lys-Arg-Val-Arg-Glu-Phe-Ile-Glu-Trp-Leu-Lys-Gln-Gly-Gly-Pro-Ser-Ser-Gly-Lys-Pro-Pro-Pro-Gly-Lys-{Lys(γGlu-C20 diacid)}
Sequence Shortening

F-{Aib}-EGTFTSDVSKQLEEKRVREFIEWLKQGGPSSGKPPPGK-{Lys(γGlu-C20 diacid)}
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (263 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Hinds C, et al. MET-097: Preclinical Characterization of a Potent and Ultra-Long-Acting GLP-1 Receptor Agonist. Diabetes, 2025, 74(Supplement_1): 794-P.

[2]. Lee S, et al. A Lineup for Next Anti-Obesity Medicines: Beyond Incretin-Based Pharmacotherapy. Pharmaceuticals (Basel, Switzerland). 2026 Jul 07;19(7):1047. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote