country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5791

Copy Link Print Information

Haplotoxin-2

Haplotoxin-2 is a peptide toxin that can be isolated from Haplopelma lividum.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Formule: C₁₆₁H₂₄₈N₄₆O₄₃S₆
Masse moléculaire:3708.36

Stockage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Haplotoxin-2 Chemical Structure

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique

Description

Haplotoxin-2 is a peptide toxin that can be isolated from Haplopelma lividum^[1].

Chemical Information

Masse moléculaire 3708.36
Formule C₁₆₁H₂₄₈N₄₆O₄₃S₆
Sequence

Ala-Cys-Lys-Gly-Leu-Phe-Val-Thr-Cys-Thr-Pro-Gly-Lys-Asp-Glu-Cys-Cys-Pro-Asn-His-Val-Cys-Ser-Ser-Lys-His-Lys-Trp-Cys-Lys-Tyr-Lys-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
Sequence Shortening

ACKGLFVTCTPGKDECCPNHVCSSKHKWCKYKI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Zhang YY, et al. Structural and Functional Diversity of Peptide Toxins from Tarantula Haplopelma hainanum (Ornithoctonus hainana) Venom Revealed by Transcriptomic, Peptidomic, and Patch Clamp Approaches. J Biol Chem. 2015 May 29;290(22):14192-207. [Content Brief]

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Obtenir un devis En stock

Other size

Obtenir un devis