FRETS-VWF73 

FRETS-VWF73, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex = 340 nm; Em = 450 nm). FRETS-VWF73 is a predictive tool for thrombotic thrombocytopenic purpura^[1][2].

Guidelines (The following are our recommended solutions. These are only guidelines and should be modified according to your specific needs)
1.1 Preparation of storage solution
FRETS-VWF73 is dissolved in DMSO to prepare 1 mM FRETS-VWF73 stock solution.
Note: FRETS-VWF73 stock solution is recommended to be aliquoted and stored at -20°C or -80°C in the dark.
1.2 Preparation of working solution
Dilute the FRETS-VWF73 stock solution to 4 μM with assay buffer.
Note: Please adjust the concentration of FRETS-VWF73 working solution according to the actual situation, and prepare it fresh each time you use it.
1.3 Experimental procedures
1) Pooled human plasma (a range of 0-8 μL as a standard), or 4 μL of each test plasma, is diluted in 100 μL of assay buffer (5 mmol/L Bis-Tris, 25 mmol/L CaCl2, 0.005% Tween-20, pH 6) in a 96-well white plate.
2) Then, 100 μL of 4 μM FRETS-VWF73 in the assay buffer is added to each well.
3) Fluorescence is measured at 30℃ in a Wallac 1420 ARVO multilabel counter equipped with a 340-nm excitation filter and a 450-nm emission filter.
4) Fluorescence is measured every 5 min. The reaction rate is calculated by linear regression analysis of fluorescence over time from 0 to 60 min using the prism software.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

8314.28

C₃₇₀H₅₈₃N₁₀₃O₁₁₃S

Solid

Light yellow to yellow

Asp-Arg-Glu-{Dap(Nma)}-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-{Dap(Dnp)}-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr-Leu-Pro-Arg-Glu-Ala-Pro-Asp-Leu-Val-Leu-Gln-Arg

DRE-{Dap(Nma)}-APNLVYMVTG-{Dap(Dnp)}-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

• [1]. Kokame K, et al. FRETS-VWF73, a first fluorogenic substrate for ADAMTS13 assay. Br J Haematol. 2005;129(1):93-100.  [Content Brief]

  [2]. Groot E, et al. FRETS-VWF73: a rapid and predictive tool for thrombotic thrombocytopenic purpura. J Thromb Haemost. 2006 Mar;4(3):698-9.  [Content Brief]