country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P10572

Copy Link Print Information

HG1 Toxin

HG1 Toxin is a peptide found in the venom of the scorpion Heterometrus fulvipes, which has the activity of inhibiting potassium channel Kv1.3. HG1 Toxin also has the activity of inhibiting trypsin (K_i=107 nM) and can be used in the study of autoimmune diseases.

For research use only. We do not sell to patients.

Formula: C₃₃₇H₅₀₃N₁₀₃O₉₇S₆
Molecular Weight:7741.62

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

HG1 Toxin Chemical Structure

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Chemical Information

Molecular Weight 7741.62
Formula C₃₃₇H₅₀₃N₁₀₃O₉₇S₆
Sequence

Gly-His-His-Asn-Arg-Val-Asn-Cys-Leu-Leu-Pro-Pro-Lys-Thr-Gly-Pro-Cys-Lys-Gly-Ser-Phe-Ala-Arg-Tyr-Tyr-Phe-Asp-Ile-Glu-Thr-Gly-Ser-Cys-Lys-Ala-Phe-Ile-Tyr-Gly-Gly-Cys-Glu-Gly-Asn-Ser-Asn-{Asn(GlcNAc)}-Phe-Ser-Glu-Lys-His-His-Cys-Glu-Lys-Arg-Cys-Arg-Gly-Phe-Arg-Lys-Phe-Gly-Gly-Lys (disulfide bridge: Cys8-Cys58;Cys17-Cys54;Cys33-Cys41)
Sequence Shortening

GHHNRVNCLLPPKTGPCKGSFARYYFDIETGSCKAFIYGGCEGNSN-{Asn(GlcNAc)}-FSEKHHCEKRCRGFRKFGGK (disulfide bridge: Cys8-Cys58;Cys17-Cys54;Cys33-Cys41)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (260 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. ZongYun Chen, et al. Hg1, novel peptide inhibitor specific for Kv1. 3 channels from first scorpion Kunitz-type potassium channel toxin family. Journal of biological chemistry 287.17 (2012): 13813-13821. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock