RALF1 peptide
Based on 1 Customer Validation
RALF1 peptide, a polypeptide found in plant kingdom (as well as in fungi and bacteria), is a FERONIA (FER) modulator. RALF1 peptide mediates rapid net H+ influx across the plasma membrane, apoplast alkalinization, rapid reversible root growth inhibition, and non-transcriptional regulation.RALF1 peptide up-regulates auxin biosynthesis genes, activates canonical TIR1/AFB auxin signaling, and mediates sustained root growth inhibition. RALF1 peptide can be used for research on the regulation of plant growth and development.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity: 98.69%
- 화학식: C228H363N77O72S4
- 분자량:5463.05
-
보관:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
All Phytohormone Isoforms
More
Biological Activity
RALF1 peptide (5 μM; 3 h) induces FER-dependent up-regulation of YUC5, YUC6, and YUC11 gene expression in Arabidopsis thaliana roots, with no direct effect on TAA/TAR gene expression, after 3 h of treatment[1].
RALF1 peptide (5 μM; 3 h) alters auxin homeostasis in Arabidopsis thaliana root tips by increasing IAA levels and its catabolites/conjugates in a FER-dependent manner, after 3 h of treatment[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
분자량 5463.05
-
화학식 C228H363N77O72S4
-
Color White to off-white
-
Sequence
Ala-Thr-Thr-Lys-Tyr-Ile-Ser-Tyr-Gln-Ser-Leu-Lys-Arg-Asn-Ser-Val-Pro-Cys-Ser-Arg-Arg-Gly-Ala-Ser-Tyr-Tyr-Asn-Cys-Gln-Asn-Gly-Ala-Gln-Ala-Asn-Pro-Tyr-Ser-Arg-Gly-Cys-Ser-Lys-Ile-Ala-Arg-Cys-Arg-Ser (disulfide bridge: Cys18-Cys28, Cys41-Cys47)
-
Sequence Shortening
ATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKIARCRS (disulfide bridge: Cys18-Cys28, Cys41-Cys47)
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
용액&용해도
DMSO : 100 mg/mL (18.30 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
순도&문서
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.1830 mL | 0.9152 mL | 1.8305 mL | 4.5762 mL |
| 5 mM | 0.0366 mL | 0.1830 mL | 0.3661 mL | 0.9152 mL | |
| 10 mM | 0.0183 mL | 0.0915 mL | 0.1830 mL | 0.4576 mL | |
| 15 mM | 0.0122 mL | 0.0610 mL | 0.1220 mL | 0.3051 mL |