country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P11138

Copy Link Print Information

Lactocin 705α

Name: Lactocin 705α
Brand: MedChemExpress
SKU: HY-P11138
Availability: PreOrder

(Synonyms: Lac705α)

Lactocin 705α (Lac705α) is a peptide component of Lactocin 705. Lactocin 705α can interact with zwitterionic DPPC bilayers. Lactocin 705α can induce the dehydration of the bilayer interfacial region. Lactocin 705α can be used in the research of bacterial infections.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Formule: C₁₆₃H₂₅₄N₄₆O₄₃S
Masse moléculaire:3578.11

Stockage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Lactocin 705α Chemical Structure

Size

Prix

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique

Description

Chemical Information

Masse moléculaire 3578.11
Formule C₁₆₃H₂₅₄N₄₆O₄₃S
Synonyms

Lac705α
Sequence

Gly-Met-Ser-Gly-Tyr-Ile-Gln-Gly-Ile-Pro-Asp-Phe-Leu-Lys-Gly-Tyr-Leu-His-Gly-Ile-Ser-Ala-Ala-Asn-Lys-His-Lys-Lys-Gly-Arg-Leu-Gly-Tyr
Sequence Shortening

GMSGYIQGIPDFLKGYLHGISAANKHKKGRLGY
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Castellano P, et al. Molecular view by fourier transform infrared spectroscopy of the relationship between lactocin 705 and membranes: speculations on antimicrobial mechanism. Appl Environ Microbiol. 2007 Jan;73(2):415-20. [Content Brief]

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Obtenir un devis En stock

Other size

Obtenir un devis