1. Others
  2. Phytohormone
  3. RALF1 peptide

RALF1 peptide, a polypeptide found in plant kingdom (as well as in fungi and bacteria), is a FERONIA (FER) modulator. RALF1 peptide mediates rapid net H+ influx across the plasma membrane, apoplast alkalinization, rapid reversible root growth inhibition, and non-transcriptional regulation.RALF1 peptide up-regulates auxin biosynthesis genes, activates canonical TIR1/AFB auxin signaling, and mediates sustained root growth inhibition. RALF1 peptide can be used for research on the regulation of plant growth and development.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

RALF1 peptide

RALF1 peptide Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 Customer Validation

Top Publications Citing Use of Products

View All Phytohormone Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

RALF1 peptide, a polypeptide found in plant kingdom (as well as in fungi and bacteria), is a FERONIA (FER) modulator. RALF1 peptide mediates rapid net H+ influx across the plasma membrane, apoplast alkalinization, rapid reversible root growth inhibition, and non-transcriptional regulation.RALF1 peptide up-regulates auxin biosynthesis genes, activates canonical TIR1/AFB auxin signaling, and mediates sustained root growth inhibition. RALF1 peptide can be used for research on the regulation of plant growth and development[1].

In Vitro

RALF1 peptide (5 μM; 3 h) induces FER-dependent up-regulation of YUC5, YUC6, and YUC11 gene expression in Arabidopsis thaliana roots, with no direct effect on TAA/TAR gene expression, after 3 h of treatment[1].
RALF1 peptide (5 μM; 3 h) alters auxin homeostasis in Arabidopsis thaliana root tips by increasing IAA levels and its catabolites/conjugates in a FER-dependent manner, after 3 h of treatment[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

5463.05

Formula

C228H363N77O72S4

Appearance

Solid

Color

White to off-white

Sequence

Ala-Thr-Thr-Lys-Tyr-Ile-Ser-Tyr-Gln-Ser-Leu-Lys-Arg-Asn-Ser-Val-Pro-Cys-Ser-Arg-Arg-Gly-Ala-Ser-Tyr-Tyr-Asn-Cys-Gln-Asn-Gly-Ala-Gln-Ala-Asn-Pro-Tyr-Ser-Arg-Gly-Cys-Ser-Lys-Ile-Ala-Arg-Cys-Arg-Ser (disulfide bridge: Cys18-Cys28, Cys41-Cys47)

Sequence Shortening

ATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKIARCRS (disulfide bridge: Cys18-Cys28, Cys41-Cys47)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (18.30 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1830 mL 0.9152 mL 1.8305 mL
5 mM 0.0366 mL 0.1830 mL 0.3661 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.1830 mL 0.9152 mL 1.8305 mL 4.5762 mL
5 mM 0.0366 mL 0.1830 mL 0.3661 mL 0.9152 mL
10 mM 0.0183 mL 0.0915 mL 0.1830 mL 0.4576 mL
15 mM 0.0122 mL 0.0610 mL 0.1220 mL 0.3051 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RALF1 peptide
Cat. No.:
HY-P10229
Quantity:
MCE Japan Authorized Agent: