1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL21
  6. 6Ckine/CCL21 Protein, Rhesus Macaque (sf9)

6Ckine/CCL21 Protein, Rhesus Macaque (sf9) is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. 6Ckine/CCL21 Protein, Rhesus Macaque (sf9) is a recombinant Rhesus Macaque  Exodus-2/CCL21 (M1-P131) expressed by Sf9 insect cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

6Ckine/CCL21 Protein, Rhesus Macaque (sf9) is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. 6Ckine/CCL21 Protein, Rhesus Macaque (sf9) is a recombinant Rhesus Macaque  Exodus-2/CCL21 (M1-P131) expressed by Sf9 insect cells[1].

Background

CCL21, also known as exodus-2 and secondary lymphoid chemokine (SLC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 9 in the human genome. It binds to glycosaminoglycan (GAG) and is anchored to the surface of endothelial cells. As a chemokine, CCL21 inhibits hematopoiesis and stimulates chemotaxis, and is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages or neutrophils. At the same time, CCL21 is a potent stimulator of T cell migration and adhesion, binding to the glycoprotein PSGL-1 on T cells to promote the migration of T cells to secondary lymphoid organs. CCL21 can act through chemokine receptors CCR7 and CXCR3. Among them, CCR7 is a GPCR that is normally expressed by T cell subsets central memory cells, thymic T cells, B cells, mature DCs and other rare cell subsets. ccl21 can function as a microglia activator in the CNS and is expressed exclusively in endangered or mechanically damaged neurons[1][2].

Species

Rhesus Macaque

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q8HYP5 (S24-P131)

Gene ID
Molecular Construction
N-term
CCL21 (S24-P131)
Accession # Q8HYP5
C-term
Protein Length

Full Length

Synonyms
C-C motif chemokine 21; Beta-chemokine exodus-2; 6Ckine; SLC; CCL21; SCYA21
AA Sequence

SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPTPRKPVQGCRKDRGVPKNGKKGKGCKRTEQSQTPKGP

Predicted Molecular Mass
12 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

6Ckine/CCL21 Protein, Rhesus Macaque (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

6Ckine/CCL21 Protein, Rhesus Macaque (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
6Ckine/CCL21 Protein, Rhesus Macaque (sf9)
Cat. No.:
HY-P76194
Quantity:
MCE Japan Authorized Agent: