Copy Link Print Information

ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi)

Customer Review

Based on 1 Customer Validation

ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived ALK-7 protein, expressed by HEK293, with C-His & C-Avi tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived ALK-7 protein, expressed by HEK293, with C-His & C-Avi tag.

Background

ALK-7 is a serine/threonine protein kinase that forms a receptor complex upon ligand binding. The receptor complex consists of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors, which autophosphorylate and subsequently bind and activate SMAD transcriptional regulators SMAD2 and SMAD3. ALK-7 serves as a receptor for activin AB, activin B, activin E, and NODAL. Upon NODAL binding, activation of ALK-7 leads to increased apoptosis and reduced proliferation by suppressing AKT signaling and activating the Smad2-dependent signaling pathway in pancreatic beta-cells, trophoblasts, epithelial cells, or neuronal cells. Additionally, ALK-7 acts as a positive regulator for macrophage activation, partially through down-regulation of PPARG expression (by similarity).

Verified Bioactivity

1.This product does not contain protein kinase domain.
2.Immobilized Biotinylated Human ALK-7, His-Avi Tag at 0.5 μg/mL (100 μL/well) on the streptavidin precoated plate (5 μg/mL). Dose response curve for Anti-ALK7 Antibody, hFc Tag with the EC50 of 1.0-10.0 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-10*His
  • Accession

    Q8NER5 (E21-E113)

  • Gene ID
    130399
  • Molecular Construction
    • N-term
    • ALK-7 (E21-E113)
      Accession # Q8NER5
    • 10*His
    • Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    ACVR1C; Activin Receptor Type-1C; Activin A Receptor Type 1C; Activin Receptor Type IC; ALK7; ACTR-IC; ACVRLK7; ALK-7; Activin Receptor-Like Kinase 7; Uncharacterized Protein ACVR1C; Activin A Receptor, Type IC

  • AA Sequence

    ELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME

  • Predicted Molecular Mass

    13.7 kDa

  • Molecular Weight

    Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 7.5, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi) Product Image
    1/16
  • ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi) Product Image