1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators Biotinylated Proteins
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Cytokine Receptors Serine/Threonine Kinase Proteins
  4. Activin/Inhibins Receptor
  5. ALK-7
  6. ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi)

ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi)

Cat. No.: HY-P704149
Instrucciones de manejo Technical Support

ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived ALK-7 protein, expressed by HEK293, with C-His & C-Avi tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
20 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived ALK-7 protein, expressed by HEK293, with C-His & C-Avi tag.

Background

ALK-7 is a serine/threonine protein kinase that forms a receptor complex upon ligand binding. The receptor complex consists of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors, which autophosphorylate and subsequently bind and activate SMAD transcriptional regulators SMAD2 and SMAD3. ALK-7 serves as a receptor for activin AB, activin B, activin E, and NODAL. Upon NODAL binding, activation of ALK-7 leads to increased apoptosis and reduced proliferation by suppressing AKT signaling and activating the Smad2-dependent signaling pathway in pancreatic beta-cells, trophoblasts, epithelial cells, or neuronal cells. Additionally, ALK-7 acts as a positive regulator for macrophage activation, partially through down-regulation of PPARG expression (by similarity).

Actividad biológica

1.This product does not contain protein kinase domain.
2.Immobilized Biotinylated Human ALK-7, His-Avi Tag at 0.5 μg/mL (100 μL/well) on the streptavidin precoated plate (5 μg/mL). Dose response curve for Anti-ALK7 Antibody, hFc Tag with the EC50 of 2.8 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-10*His

Accession

Q8NER5 (L22-E113)

Gene ID

130399

Molecular Construction
N-term
ALK-7 (L22-E113)
Accession # Q8NER5
10*His
Avi
C-term
Protein Length

Extracellular Domain

Conjugation

Biotin

Conjugate Method

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

Synonyms
Activin receptor type IC; ACTR-IC; ACVRLK7; ALK7
AA Sequence

LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME

Predicted Molecular Mass
13.7 kDa
Peso molecular

Approximately 20-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Pureza

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 7.5, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
ALK-7 Protein, Human (Biotinylated, HEK293, His, Avi)
Cat. No.:
HY-P704149
Cantidad:
MCE Japan Authorized Agent: