Copy Link Print Information

ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Angiopoietin-like protein 4, Human modulates the disposition of circulating triglycerides (TG) by inhibiting lipoprotein lipase (LPL). Angiopoietin-Related Protein 4 is a conventional, non-competitive inhibitor that binds to LPL to prevent the hydrolysis of substrate as part of reversible mechanism.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Angiopoietin-like protein 4, Human modulates the disposition of circulating triglycerides (TG) by inhibiting lipoprotein lipase (LPL). Angiopoietin-Related Protein 4 is a conventional, non-competitive inhibitor that binds to LPL to prevent the hydrolysis of substrate as part of reversible mechanism.

Background

Angiopoietin-like proteins (ANGPTLs) represent a family of eight secreted glycoproteins that show structural homology to angiopoietins and carry distinct physiological functions, including putative roles in lipid metabolism, expansion of stem cells, inflammation, tissue remodeling and angiogenesis. In recent years, three ANGPTLs, ANGPTL3, ANGPTL4 and ANGP-TL8, have been shown to play a role in lipid metabolism and in the regulation of plasma lipid levels. ANGPTL4 and ANGPTL8 form a complex when refolded together and that ANGPTL4 in that complex loses its ability to inactivate LPL. Angiopoietin-like protein 4 (ANGPTL4) is a secreted 50 kD protein that modulates the disposition of circulating triglycerides (TG) by inhibiting lipoprotein lipase (LPL). ANGPTL4 is a positive acute phase protein and its increase could contribute to the hypertriglyce­ridemia that characteristically occurs during the acute phase response by inhibiting LPL activity.

Verified Bioactivity

1.Measured by its binding ability in a functional ELISA. When Recombinant Human Angiopoietin-like 4/ANGPTL4 is immobilized at 1 μg/mL, 100 μL/well can bind Biotinylated Human LILRB2 (HY-P70168). The ED50 for this effect is <350 ng/mL.
2.Human LILRB2 immobilized on CM5 Chip can bind ANGPTL4 with an affinity constant of 71.05 nM as determined in a SPR assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human Angiopoietin-like 4/ANGPTL4 is immobilized at 1 μg/mL, 100 μL/well can bind Biotinylated Human LILRB2 (HY-P70168). The ED50 for this effect is 327.9 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-6*His
  • Accession

    Q9BY76-1(P166-S406)

  • Gene ID
    51129  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • ANGPTL4 (P166-S406)
      Accession # Q9BY76-1
    • C-term
  • Protein Length

    Full Length of ANGPTL4 C-terminal Chain

  • Synonyms

    ANGPTL4; Peroxisome Proliferator-Activated Receptor (PPAR) Gamma Induced Angiopoietin-Related Protein; Angiopoietin Like 4; Hepatic Angiopoietin-Related Protein; HFARP; PPARG Angiopoietin Related Protein; PGAR; Fasting-Induced Adipose Factor; ARP4; Angiopoietin-Like Protein 4; Hepatic Fibrinogen/Angiopoietin-Related Protein; Angiopoietin-Like 4; Angiopoietin-Related Protein 4; UNQ171; Pp1158; TGQTL; FIAF; HARP; NL2

  • AA Sequence

    PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS

  • Molecular Weight

    Approximately 31-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 100 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Michael J Lafferty, et al. Angiopoietin-like Protein 4 Inhibition of Lipoprotein Lipase: Evidence for Reversible Complex Formation J Biol Chem. 2013 Oct 4;288(40):28524-34. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human Angiopoietin-like 4/ANGPTL4 is immobilized at 1 μg/mL, 100 μL/well can bind Biotinylated Human LILRB2 (HY-P70168). The ED50 for this effect is 327.9 ng/mL.

  • 1/16

    ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Sci Total Environ. 2024 Feb 20:912:168949. [Abstract]

    Customer Validation
     CCK-8 assay performed in SK-N-BE(2)C cells with recombinant human ANGPTL4 protein (ANGPTL4/Angiopoietin-related 4 Protein) treatment.

  • 1/16

    ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Sci Total Environ. 2024 Feb 20:912:168949. [Abstract]

    Customer Validation
     ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 100 ng/mL; 48 h) responded to MEHP-induced migration promotion in SK-N-BE(2)C cells. Wound healing assay and quantitative analysis after ANGPTL4 protein treatment.

  • 1/16

    ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]

    Customer Validation
     Representative image of HE staining in the atrial tissues of mice. The arrow indicates the infiltrated inflammatory cells. Histological pathology was performed using HE staining to assess the influence of ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507) on inflammation and apoptosis of atrial tissue. ANGPTL4 attenuated the Ang II infusion which induced increase in inflammatory cell infiltration in atrial tissue of mice.

  • 1/16

    ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]

    Customer Validation
     TUNEL staining of atrial tissues for apoptosis detection. TUNEL staining revealed that the Ang II-induced atrial apoptosis in WT mice decreased in ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507)-treated mice.

  • 1/16

    ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]

    Customer Validation
     RT-qPCR analyses of IL-1β and IL-6 levels in atrial tissues. n = 6 mice per group. The results showed that ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507) reduced the elevated mRNA levels of two pro-inflammatory cytokines, IL-1β and IL-6, induced by Ang II in mice.

  • 1/16

    ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]

    Customer Validation
     ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507) significantly inhibited the reduction in fatty acid metabolism-related protein expression induced by Ang II in mice.

  • ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • Experimental Validation Results for ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
  • ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) Product Image

  • ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Sci Total Environ. 2024 Feb 20:912:168949. [Abstract]

    CCK-8 assay performed in SK-N-BE(2)C cells with recombinant human ANGPTL4 protein (ANGPTL4/Angiopoietin-related 4 Protein) treatment.

  • ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Sci Total Environ. 2024 Feb 20:912:168949. [Abstract]

    ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 100 ng/mL; 48 h) responded to MEHP-induced migration promotion in SK-N-BE(2)C cells. Wound healing assay and quantitative analysis after ANGPTL4 protein treatment.

  • ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]

    Representative image of HE staining in the atrial tissues of mice. The arrow indicates the infiltrated inflammatory cells. Histological pathology was performed using HE staining to assess the influence of ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507) on inflammation and apoptosis of atrial tissue. ANGPTL4 attenuated the Ang II infusion which induced increase in inflammatory cell infiltration in atrial tissue of mice.

  • ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]

    TUNEL staining of atrial tissues for apoptosis detection. TUNEL staining revealed that the Ang II-induced atrial apoptosis in WT mice decreased in ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507)-treated mice.

  • ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]

    RT-qPCR analyses of IL-1β and IL-6 levels in atrial tissues. n = 6 mice per group. The results showed that ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507) reduced the elevated mRNA levels of two pro-inflammatory cytokines, IL-1β and IL-6, induced by Ang II in mice.

  • ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]

    ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507) significantly inhibited the reduction in fatty acid metabolism-related protein expression induced by Ang II in mice.