ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)
Based on 2 publication(s) in Google Scholar
Angiopoietin-like protein 4, Human modulates the disposition of circulating triglycerides (TG) by inhibiting lipoprotein lipase (LPL). Angiopoietin-Related Protein 4 is a conventional, non-competitive inhibitor that binds to LPL to prevent the hydrolysis of substrate as part of reversible mechanism.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Angiopoietin-like protein 4, Human modulates the disposition of circulating triglycerides (TG) by inhibiting lipoprotein lipase (LPL). Angiopoietin-Related Protein 4 is a conventional, non-competitive inhibitor that binds to LPL to prevent the hydrolysis of substrate as part of reversible mechanism.
Background
Angiopoietin-like proteins (ANGPTLs) represent a family of eight secreted glycoproteins that show structural homology to angiopoietins and carry distinct physiological functions, including putative roles in lipid metabolism, expansion of stem cells, inflammation, tissue remodeling and angiogenesis. In recent years, three ANGPTLs, ANGPTL3, ANGPTL4 and ANGP-TL8, have been shown to play a role in lipid metabolism and in the regulation of plasma lipid levels. ANGPTL4 and ANGPTL8 form a complex when refolded together and that ANGPTL4 in that complex loses its ability to inactivate LPL. Angiopoietin-like protein 4 (ANGPTL4) is a secreted 50 kD protein that modulates the disposition of circulating triglycerides (TG) by inhibiting lipoprotein lipase (LPL). ANGPTL4 is a positive acute phase protein and its increase could contribute to the hypertriglyceridemia that characteristically occurs during the acute phase response by inhibiting LPL activity.
Verified Bioactivity
1.Measured by its binding ability in a functional ELISA. When Recombinant Human Angiopoietin-like 4/ANGPTL4 is immobilized at 1 μg/mL, 100 μL/well can bind Biotinylated Human LILRB2 (HY-P70168). The ED50 for this effect is <350 ng/mL.
2.Human LILRB2 immobilized on CM5 Chip can bind ANGPTL4 with an affinity constant of 71.05 nM as determined in a SPR assay.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Cardiol Res Pract
ANGPTL4 Attenuates Ang II-Induced Atrial Fibrillation and Fibrosis in Mice via PPAR Pathway. [Abstract]2021 Aug 9:2021:9935310. PMID: 34422410
ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]
Representative image of HE staining in the atrial tissues of mice. The arrow indicates the infiltrated inflammatory cells. Histological pathology was performed using HE staining to assess the influence of ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507) on inflammation and apoptosis of atrial tissue. ANGPTL4 attenuated the Ang II infusion which induced increase in inflammatory cell infiltration in atrial tissue of mice.
ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]
TUNEL staining of atrial tissues for apoptosis detection. TUNEL staining revealed that the Ang II-induced atrial apoptosis in WT mice decreased in ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507)-treated mice.
ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]
RT-qPCR analyses of IL-1β and IL-6 levels in atrial tissues. n = 6 mice per group. The results showed that ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507) reduced the elevated mRNA levels of two pro-inflammatory cytokines, IL-1β and IL-6, induced by Ang II in mice.
ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cardiol Res Pract. 2021 Aug 9:2021:9935310. [Abstract]
ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 20 μg/kg; i.p.; once daily for 3 weeks; HY-P7507) significantly inhibited the reduction in fatty acid metabolism-related protein expression induced by Ang II in mice.
-
Sci Total Environ
PPARβ/δ-ANGPTL4 axis mediates the promotion of mono-2-ethylhexyl phthalic acid on MYCN-amplified neuroblastoma development. [Abstract]2024 Feb 20:912:168949. PMID: 38042186
ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Sci Total Environ. 2024 Feb 20:912:168949. [Abstract]
CCK-8 assay performed in SK-N-BE(2)C cells with recombinant human ANGPTL4 protein (ANGPTL4/Angiopoietin-related 4 Protein) treatment.
ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Sci Total Environ. 2024 Feb 20:912:168949. [Abstract]
ANGPTL4/Angiopoietin-related 4 Protein (ANGPTL4, 100 ng/mL; 48 h) responded to MEHP-induced migration promotion in SK-N-BE(2)C cells. Wound healing assay and quantitative analysis after ANGPTL4 protein treatment.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Accession
Q9BY76-1(P166-S406)
-
Molecular Construction
-
N-term
-
6*His
-
ANGPTL4 (P166-S406)
Accession # Q9BY76-1 -
C-term
-
-
Protein Length
Full Length of ANGPTL4 C-terminal Chain
-
Synonyms
ANGPTL4; Peroxisome Proliferator-Activated Receptor (PPAR) Gamma Induced Angiopoietin-Related Protein; Angiopoietin Like 4; Hepatic Angiopoietin-Related Protein; HFARP; PPARG Angiopoietin Related Protein; PGAR; Fasting-Induced Adipose Factor; ARP4; Angiopoietin-Like Protein 4; Hepatic Fibrinogen/Angiopoietin-Related Protein; Angiopoietin-Like 4; Angiopoietin-Related Protein 4; UNQ171; Pp1158; TGQTL; FIAF; HARP; NL2
-
AA Sequence
PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
-
Molecular Weight
Approximately 31-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 100 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)