ANGPTL4/Angiopoietin-related 4 Protein, Human (HEK293, His)

Angiopoietin-like protein 4, Human modulates the disposition of circulating triglycerides (TG) by inhibiting lipoprotein lipase (LPL). Angiopoietin-Related Protein 4 is a conventional, non-competitive inhibitor that binds to LPL to prevent the hydrolysis of substrate as part of reversible mechanism.

Angiopoietin-like proteins (ANGPTLs) represent a family of eight secreted glycoproteins that show structural homology to angiopoietins and carry distinct physiological functions, including putative roles in lipid metabolism, expansion of stem cells, inflammation, tissue remodeling and angiogenesis. In recent years, three ANGPTLs, ANGPTL3, ANGPTL4 and ANGP-TL8, have been shown to play a role in lipid metabolism and in the regulation of plasma lipid levels. ANGPTL4 and ANGPTL8 form a complex when refolded together and that ANGPTL4 in that complex loses its ability to inactivate LPL. Angiopoietin-like protein 4 (ANGPTL4) is a secreted 50 kD protein that modulates the disposition of circulating triglycerides (TG) by inhibiting lipoprotein lipase (LPL). ANGPTL4 is a positive acute phase protein and its increase could contribute to the hypertriglyce­ridemia that characteristically occurs during the acute phase response by inhibiting LPL activity.

1.Measured by its binding ability in a functional ELISA. When Recombinant Human Angiopoietin-like 4/ANGPTL4 is immobilized at 1 μg/mL, 100 μL/well can bind Recombinant Human LILRB2/CD85d/ILT4. The ED₅₀ for this effect is <350 ng/mL.
2.Human LILRB2 immobilized on CM5 Chip can bind ANGPTL4 with an affinity constant of 71.05 nM as determined in a SPR assay.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human Angiopoietin-like 4/ANGPTL4 is immobilized at 1 μg/mL, 100 μL/well can bind Recombinant Human LILRB2/CD85d/ILT4. The ED₅₀ for this effect is 327.9 ng/mL.

Human

HEK293

N-6*His

Q9BY76-1(P166-S406)

51129  [NCBI]

Partial

PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS

Approximately 31-38 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 100 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Michael J Lafferty, et al. Angiopoietin-like Protein 4 Inhibition of Lipoprotein Lipase: Evidence for Reversible Complex Formation J Biol Chem. 2013 Oct 4;288(40):28524-34.  [Content Brief]