Copy Link Print Information

Animal-Free BMP-5 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

BMP-5 protein is an important member of the TGF-β superfamily and is essential for cartilage and bone formation as well as neurogenesis. It activates canonical BMP signaling through BMPR1A and BMPR2 and phosphorylates SMAD1/5/8 for gene transcription regulation. Animal-Free BMP-5 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-5 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free BMP-5 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

BMP-5 protein is an important member of the TGF-β superfamily and is essential for cartilage and bone formation as well as neurogenesis. It activates canonical BMP signaling through BMPR1A and BMPR2 and phosphorylates SMAD1/5/8 for gene transcription regulation. Animal-Free BMP-5 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-5 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

BMP-5 Protein, a crucial member of the TGF-beta superfamily, plays indispensable roles in various developmental processes, including cartilage and bone formation, as well as neurogenesis. It triggers the canonical BMP signaling cascade by binding to type I receptor BMPR1A and type II receptor BMPR2, leading to the phosphorylation of SMAD1/5/8, which modulate gene transcription. Additionally, BMP-5 can engage non-canonical pathways, such as the MAPK p38 signaling cascade, promoting chondrogenic differentiation. Notably, it promotes the expression of HAMP, a process regulated by its interaction with ERFE, which inhibits BMP-induced transcription of HAMP. The intricate signaling network involving BMP-5 underscores its versatile regulatory functions in diverse cellular processes.

Verified Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells.The ED50 for this effect is <0.17 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P22003 (A317-H454)

  • Gene ID
    653  [NCBI]
  • Molecular Construction
    • N-term
    • BMP-5 (A317-H454)
      Accession # P22003
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    BMP5; Bone Morphogenenic Protein-5; Bone Morphogenetic Protein 5; BMP-5

  • AA Sequence

    AANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH

  • Predicted Molecular Mass

    16.6 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free BMP-5 Protein, Human (His) Product Image
    1/16
  • Animal-Free BMP-5 Protein, Human (His) Product Image