Animal-Free FGF-8b Protein, Human/Mouse (His)

Customer Review

Based on 1 Customer Validation

Animal-Free FGF-8b Protein, Human/Mouse (His) is the recombinant human-derived animal-FreeFGF-8b protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse; Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Animal-Free FGF-8b Protein, Human/Mouse (His) is the recombinant human-derived animal-FreeFGF-8b protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Background

FGF-8b plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation, and cell migration. It is required for normal brain, eye, ear, and limb development during embryogenesis. Additionally, FGF-8b is essential for the normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (by similar: PubMed:16384934, PubMed:16597617, PubMed:8663044). It also functions in neurite outgrowth in hippocampal cells (by similar: PubMed:21576111).

Verified Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 1.4-3.8 ng/mL. The specific activity of recombinant human FGF-8b is >2 x 105IU/mg

Technical Parameters

  • Species Mouse; Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FGF-8b (Q34-R215)
      Accession # P55075-3/P37237-2
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FGF8; HBGF-8; Fibroblast Growth Factor 8; FGF-8; AIGF; Fibroblast Growth Factor; Androgen-Induced Growth Factor; KAL6; Fibroblast Growth Factor 8 (Androgen-Induced); HH6; Heparin-Binding Growth Factor 8; FGF

  • AA Sequence

    QHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

  • Predicted Molecular Mass

    22.1 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 0.1% sarkosyl in PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00