Animal-Free GDF-5 Protein, Human (His)
Based on 1 Customer Validation
The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. Animal-Free GDF-5 Protein, Human (His) is the recombinant human-derived animal-FreeGDF-5 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. Animal-Free GDF-5 Protein, Human (His) is the recombinant human-derived animal-FreeGDF-5 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Background
GDF-5 Protein plays a pivotal role in bone and cartilage formation, intricately regulating chondrogenic tissue differentiation through dual pathways. Firstly, it positively influences chondrogenic tissue differentiation by binding with high affinity to BMPR1B and with lower affinity to BMPR1A, leading to the induction of SMAD1-SMAD5-SMAD8 complex phosphorylation and subsequent SMAD protein signaling transduction. Simultaneously, it negatively regulates chondrogenic differentiation through interaction with NOG. This protein is essential for preventing excessive muscle loss upon denervation, a function mediated by phosphorylated SMAD1/5/8. Additionally, GDF-5 binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. Structurally, it forms homodimers linked by disulfide bonds and interacts with serine proteases HTRA1 and HTRA3. Following LPS binding, GDF-5 may form a complex with CXCR4, HSP90AA1, and HSPA8. Moreover, it interacts with high affinity with NOG to inhibit chondrogenesis and with BMPR1B and BMPR1A to positively regulate chondrocyte differentiation through SMAD-dependent signaling. Additionally, it engages in interactions with FBN1 and FBN2.
Verified Bioactivity
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <14 ng/mL
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P43026 (A382-R501)
-
Molecular Construction
-
N-term
-
GDF-5 (A382-R501)
Accession # P43026 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GDF5; LAP-4; Growth Differentiation Factor 5; Cartilage-Derived Morphogenetic Protein 1; CDMP1; GDF5 Protein; BMP14; DUPANS; Growth/Differentiation Factor 5; CDMP-1; Bone Morphogenetic Protein 14; BDA1C; Cartilage-Derived Morphogenetic Protein-1; SYM1B; L
-
AA Sequence
APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
-
Predicted Molecular Mass
14.5 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)