Animal-Free IL-13 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

IL-13 Protein is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. Animal-Free IL-13 Protein, Human (His) is the recombinant human-derived animal-FreeIL-13 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-13 Protein is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. Animal-Free IL-13 Protein, Human (His) is the recombinant human-derived animal-FreeIL-13 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

Interleukin-13 (IL-13) is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. IL-13 synergizes with IL2 in regulating interferon-gamma synthesis. IL-13 exerts its biological effects through the IL4R chain and the IL13RA1 chain, to activate JAK1, TYK2 and STAT6. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and stimulates B-cell proliferation, and activation of eosinophils, basophils, and mast cells. In human macrophages and monocytes, hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent[1][2][3][4][5][6].

Verified Bioactivity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is<0.8 ng/mL. The specific activity of recombinant human IL- 13 is approximately >1 x106 IU/ mg

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-13 (G35-N146)
      Accession # P35225
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788

  • AA Sequence

    GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN

  • Predicted Molecular Mass

    13.3 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00