Animal-Free IL-13 Protein, Human (His)

IL-13 Protein is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. Animal-Free IL-13 Protein, Human (His) is the recombinant human-derived animal-FreeIL-13 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-13 Protein, Human (His) is 112 a.a., with molecular weight of ~13.28 kDa.

Interleukin-13 (IL-13) is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. IL-13 synergizes with IL2 in regulating interferon-gamma synthesis. IL-13 exerts its biological effects through the IL4R chain and the IL13RA1 chain, to activate JAK1, TYK2 and STAT6. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and stimulates B-cell proliferation, and activation of eosinophils, basophils, and mast cells. In human macrophages and monocytes, hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent^{[1][2][3][4][5][6]}.

Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is<0.8 ng/mL. The specific activity of recombinant human IL- 13 is approximately >1 x10⁶ IU/ mg

Human

E. coli

C-His

P35225 (G35-N146)

3596  [NCBI]

MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Approximately 13.28 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.