Copy Link Print Information

Animal-Free IL-16 Protein, Mouse (His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

IL-16 is a modulator in inflammatory processes and tumorigenesis. IL16 can bind to the CD4 molecule and activate monocytes and stimulates the secretion of inflammatory cytokines. Besides, IL16 can induce expression of IL2Rα and β, and synergize with IL2 to augment CD4+ T cell activation and proliferation. IL16 can induce migration in CD4+ lymphocytes, monocytes, and eosinophils as a chemoattractant factor. Animal-Free IL-16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-16 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free IL-16 Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-16 is a modulator in inflammatory processes and tumorigenesis. IL16 can bind to the CD4 molecule and activate monocytes and stimulates the secretion of inflammatory cytokines. Besides, IL16 can induce expression of IL2Rα and β, and synergize with IL2 to augment CD4+ T cell activation and proliferation. IL16 can induce migration in CD4+ lymphocytes, monocytes, and eosinophils as a chemoattractant factor[1][2][3]. Animal-Free IL-16 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-16 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

IL-16, a pleiotropic cytokine, is a modulator in inflammatory processes and tumorigenesis. IL16 can bind to the CD4 molecule and activate monocytes and stimulates the secretion of inflammatory cytokines, such as TNF-α, IL1β, IL6, and IL15[1]. Besides, IL16 can induce expression of IL2Rα and β, and synergize with IL2 to augment CD4+ T cell activation and proliferation. In addition, IL16 can induce migration in CD4+ lymphocytes, monocytes, and eosinophils as a chemoattractant factor[2].
IL-16 is constitutively expressed in a variety of cells, such as T cells, B cells, mast cells, eosinophils, and epithelial cells[2]. IL-16 is mainly produced by CD4+ and CD8+ cells as a precursor protein (pro-IL-16). Pro-IL-16 is enzymatically cleaved by caspase 3, inducing the release of bioactive mature form of IL-16[3]. Human IL-16 shares about 80% aa sequence identity with mouse.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession

    O54824-1 (H1197-S1322)

  • Gene ID
    16170  [NCBI]
  • Molecular Construction
    • N-term
    • IL-16 (H1197-S1322)
      Accession # O54824-1
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL16; FLJ42735; Interleukin 16; FLJ16806; Pro-Interleukin-16; IL-16; PrIL-16; Interleukin 16 (Lymphocyte Chemoattractant Factor); LCF; Neuronal Interleukin 16; Lymphocyte Chemoattractant Factor; IL16 Protein; Prointerleukin 16; PRIL16; HsT19289; NIL16

  • AA Sequence

    HDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

  • Predicted Molecular Mass

    14 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free IL-16 Protein, Mouse (His) Product Image
    1/16
  • Animal-Free IL-16 Protein, Mouse (His) Product Image