1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-19
  5. Animal-Free IL-19 Protein, Human (His)

Animal-Free IL-19 Protein, Human (His) is the recombinant human-derived animal-FreeIL-19 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

Animal-Free IL-19 Protein, Human (His) is the recombinant human-derived animal-FreeIL-19 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Background

The IL-19 Protein operates as a multifaceted cytokine, acting as both an anti-inflammatory and proangiogenic factor. It plays a pivotal role in polarizing adaptive immunity towards an anti-inflammatory phenotype by inducing T-helper 2 responses. This involves a dual mechanism of down-regulating IFN-gamma and up-regulating IL4 and IL5. Notably produced by osteocytes, IL-19 further stimulates granulopoiesis and the formation of neutrophils. Its biological effects are mediated through a receptor complex composed of the IL20RA and IL20RB heterodimer. Upon binding, IL-19 activates the Janus kinase (JAK) and signal transducer and activator of transcription (STAT) pathway, with particular emphasis on STAT3, contributing to its diverse immunomodulatory functions.

Biological Activity

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <1.2 ng/mL

Species

Human

Source

E. coli

Tag

C-6*His

Accession

AAK91776.1 (L63-A215)

Gene ID
Molecular Construction
N-term
IL-19 (L63-A215)
Accession # AAK91776.1
6*His
C-term
Protein Length

Partial

Synonyms
Melanoma differentiation association like protein; ZMDA1
AA Sequence

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Predicted Molecular Mass
18.7 kDa
분자량

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

Animal-Free IL-19 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Animal-Free IL-19 Protein, Human (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Animal-Free IL-19 Protein, Human (His)
Cat. No.:
HY-P700109AF
수량:
MCE Japan Authorized Agent: