Animal-Free IL-7 Protein, Human (His)

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. Animal-Free IL-7 Protein, Human (His) is the recombinant human-derived animal-FreeIL-7 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

The IL-7 protein serves as a crucial hematopoietic cytokine, playing an indispensable role in the development, expansion, and survival of both naive and memory T-cells as well as B-cells, thereby regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. Its biological effects are executed through a receptor comprised of the IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Upon binding to the receptor, IL-7 activates various kinases, including JAK1 or JAK3, depending on the cell type. This activation leads to the propagation of signals through multiple downstream pathways, such as the PI3K/Akt/mTOR or the JAK-STAT5 pathways. IL-7's interaction with IL7R and CSF2RG highlights its pivotal role in orchestrating diverse signaling cascades crucial for immune cell development and function.

Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human IL-7 is >7 x 10⁸ IU/mg.

Human

E. coli

C-6*His

P13232-1 (D26-H177)

3574  [NCBI]

Full Length of Isoform-1 Mature Protein

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose or PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.