Copy Link Print Information

Biglycan Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

Biglycan proteins may be involved in collagen fiber assembly, suggesting a role in organizing and building collagen networks. Its involvement suggests a crucial function in extracellular matrix formation and maintenance. Biglycan Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Biglycan protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Biglycan Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for Biglycan Protein, Mouse (HEK293, Fc)
  • Biglycan Protein, Mouse (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Biglycan proteins may be involved in collagen fiber assembly, suggesting a role in organizing and building collagen networks. Its involvement suggests a crucial function in extracellular matrix formation and maintenance. Biglycan Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Biglycan protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Biglycan Protein emerges as a potential participant in collagen fiber assembly, suggesting a role in the intricate processes of organizing and structuring collagen networks. Its involvement in collagen fiber assembly implies a crucial function in the formation and maintenance of the extracellular matrix. As an essential component of connective tissues, Biglycan may contribute to the stability and integrity of collagen fibers. Elucidating the specific mechanisms through which Biglycan participates in collagen assembly could provide valuable insights into its role in tissue development, repair, and homeostasis. Further exploration of Biglycan's functions may deepen our understanding of its implications in connective tissue biology and its potential significance in various physiological contexts.

Verified Bioactivity

1.Measured by its ability to inhibit the cell growth of mouse NIH-3T3 mouse embryonic fibroblast adipose-like cells. The ED50 for this effect is 0.5711 μg/mL, corresponding to a specific activity is 1.751×103units/mg.
2.Measured by its ability to inhibit the cell growth of mouse 3T3-L1 mouse embryonic fibroblast adipose-like cells. The ED50 for this effect is 0.75-3.5 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the cell growth of mouse NIH-3T3 mouse embryonic fibroblast adipose-like cells. The ED50 for this effect is 0.5711 μg/mL, corresponding to a specific activity is 1.751×103 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession

    P28653 (D38-K369)

  • Gene ID
    12111  [NCBI]
  • Molecular Construction
    • N-term
    • Biglycan (D38-K369)
      Accession # P28653
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    BGN; Small Leucine-Rich Protein 1A; Biglycan; Bone/Cartilage Proteoglycan I; SLRR1A; Biglycan Proteoglycan; DSPG1; SEMDX; PG-S1; MRLS; Dermatan Sulphate Proteoglycan I; PGI; Bone/Cartilage Proteoglycan-I

  • AA Sequence

    DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

  • Molecular Weight

    Approximately 67-120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit the cell growth of mouse NIH-3T3 mouse embryonic fibroblast adipose-like cells. The ED50 for this effect is 0.5711 μg/mL, corresponding to a specific activity is 1.751×103 units/mg.

  • Biglycan Protein, Mouse (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for Biglycan Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for Biglycan Protein, Mouse (HEK293, Fc)
  • Biglycan Protein, Mouse (HEK293, Fc) Product Image