BMP-4 Protein, Human (CHO)

Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells^[1]. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A)^[2] to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects^[3]. BMP-4 Protein, Human (CHO) has a total length of 116 amino acids (S293-R408), is expressed in CHO cells with tag free.

Bone Morphogenetic Protein 4 (BMP-4) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-4 involves in the vasculature circulation and can activate receptors on vascular cells^[1].
BMP-4/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms^[4].
BMP-4 is widely found in different animals, while the sequence in human is highly similar to Rat (96.81%), and mouse (97.54%).
BMP-4 is expressed by endothelial cells (ECs) in response to hypoxia and promotes vascular SMC proliferation. Therefore it inhibits the proliferation of smooth muscle cells (SMCs) isolated from the proximal pulmonary artery while induces proliferation of SMCs isolated from distal pulmonary arteries^[5].
BMP-4 appears to be a marker and driver of vascular calcification, particularly in atherosclerosis^[6].
BMP-4 induces angiogenesis, endothelial cells (ECs) proliferation, and migration^[7].
BMP-4 is differentially expressed in calcified atherosclerotic plaques^[8], serves as the linkers between atherosclerotic vascular calcification with mechanisms of normal bone formation^[9].
BMP-4 increases plaque formation via their pro-inflammatory and pro-atherogenic effects, promoting oxidative stress, endothelial dysfunction and osteogenic differentiation^[3].

BMP-4 (1 ng/mL for 4-5 d; 10 ng/mL for 3-4 d; 100 ng/mL for 2 d) induces a synchronous wave of differentiation occurred, characterized by flattened, enlarged cells with reduced proliferation^[10].
BMP-4 (100 ng/mL; 7 d) initiates human embryonic stem cell differentiation to trophoblast^[10].
BMP4 (10 or 100 ng/mL; 24 h) significantly increases the number of mesenchymal condensations by approximately 50%^[11].

Human BMP-4 Protein, premium grade stimulates Human BMP (Luc) HEK293 Reporter cells. The EC₅₀ for this effect is 1.0-10.0 ng/mL.

Human

CHO

Tag Free

P12644/NP_001193.2 (S293-R408)

652

Full Length of Mature Protein

SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Na₂CO₃, 5 mM DTT, pH 11.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCL, 500 mM arginine, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 30% Acetonitrile, pH 2.5.
4.Lyophilized from a 0.22 μm filtered solution of 20 mM Citric acid, pH 2.2 with 11% trehalose as protectant.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<0.01 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.