CCL24/Eotaxin-2 Protein, Human
Based on 1 publication(s) in Google Scholar
CCL24/Eotaxin-2 Protein, Human is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Human is a recombinant human CCL24/Eotaxin-2 (V27-A104) protein expressed by E. coli.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
CCL24/Eotaxin-2 Protein, Human is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Human is a recombinant human CCL24/Eotaxin-2 (V27-A104) protein expressed by E. coli[1].
CCL24, also known as eosinophil chemotactic protein 2 (eotaxin-2) and myeloid progenitor inhibitory factor 2 (MPIF-2), is a small cytokine of the CC chemokine family, located on chromosome 7 in the human genome. CCL24 is highly chemotactic for resting T lymphocytes and eosinophils and has low chemotactic activity for neutrophils, but not for monocytes and activated lymphocytes. By binding to its sole receptor CCR3, of which CCR3, is present mainly on eosinophils, but also on basophils, monocytes, Th2 lymphocytes, epithelial cells and airway smooth muscle. CCL24 mainly mediates atopic diseases, parasitic infections and systemic diseases, but also promotes cellular transport and regulates inflammatory and fibrotic activities[1][2].
CCL24 (human, 0.1-100 ng/mL, 48 h) stimulates apoptosis of DSC and is attenuated with increasing concentrations of CCL24，also promotes metaphase stromal cells (DSC) proliferation at concentrations of 1 and 10 ng/mL[1].
CCL24 (25 ng/mL, 48 h) can induce LX-2 cell motility, significantly increase α-SMA expression and procollagen I secretion, thereby inducing a pro-fibrotic effect in human HSC[2].
CCL24 (human, 0.01-10 μg, intradermal injection) can induce the production of rubella and flare reactions in a dose-dependent manner, and eosinophil infiltration[3].
1.Full biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration of 50-100 ng/mL.
2.Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CCR3.The ED50 for this effect is 0.035 μg/mL, corresponding to a specific activity is 2.82×104 U/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Death Dis
Mechanical stiffness promotes skin fibrosis via Piezo1-Wnt2/Wnt11-CCL24 positive feedback loop. [Abstract]2024 Jan 24;15(1):84. PMID: 38267432
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O00175 (V27-A104)
-
Molecular Construction
-
N-term
-
CCL24 (V27-A104)
Accession # O00175 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CCL24; CK-Beta-6; Prev. SCYA24; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 24; Eotaxin-2; Eosinophil Chemotactic Protein 2; MPIF-2; Chemokine (C-C Motif) Ligand 24; MPIF2; Small-Inducible Cytokine A24; Myeloid Progenitor Inhibitory Factor 2; C
-
AA Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA
-
Predicted Molecular Mass
8.8 kDa
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, pH 7.4, 150 mM NaCl.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6(6):1028-37. [Content Brief]
[2]. Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2(1):100064. [Content Brief]
[3]. Andrew Menzies-Gow, et al. Eotaxin (CCL11) and eotaxin-2 (CCL24) induce recruitment of eosinophils, basophils, neutrophils, and macrophages as well as features of early- and late-phase allergic reactions following cutaneous injection in human atopic and nonatopic volunteers. J Immunol. 2002 Sep 1;169(5):2712-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
