1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC chemokine subfamily
  5. CCL24/Eotaxin-2 Protein, Human

CCL24/Eotaxin-2 Protein, Human

Cat. No.: HY-P7161
Handling Instructions

CCL24/Eotaxin-2 Protein, Human chemoattracts CCR3 bearing cells such as eosinophils, mast cells, basophils, and Th2 cells that play a role in allergic disorders.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

CCL24/Eotaxin-2 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

CCL24/Eotaxin-2 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O00175 (V27-A104)

Gene ID

6369

Synonyms
rHuEotaxin-2/CCL24; C-C motif chemokine 24; CK-beta-6; MPIF-2; MPIF2; SCYA24
AA Sequence

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA

Molecular Weight

Approximately 8.8 kDa

Biological Activity
Full biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration of 50-100 ng/ml.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CCL24 mainly mediates atopic disorders, parasitic infections and systemic diseases via binding to its only receptor CCR3. CCL24 increases the proliferation and apoptosis of DSCs, whereas on the whole it promotes the number of DSCs. CCL24 is a beneficial factor for the process of decidualization in human early pregnancy[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL24/Eotaxin-2 Protein, Human
Cat. No.:
HY-P7161
Quantity:
MCE Japan Authorized Agent: