CTACK/CCL27 Protein, Mouse

Customer Review

Based on 1 Customer Validation

CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

Background

CCL27 protein acts as a chemotactic factor specifically attracting skin-associated memory T-lymphocytes, potentially playing a crucial role in mediating the homing of lymphocytes to cutaneous sites. This chemokine may also participate in cell migration during embryogenesis. Notably, nuclear forms of CCL27 may contribute to cellular migration by inducing cytoskeletal relaxation. The protein binds to the CCR10 receptor and exists in monomeric, dimeric, and tetrameric forms, with heparin avidly promoting oligomerization. Furthermore, CCL27 interacts with TNFAIP6, specifically via its Link domain.

Verified Bioactivity

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CCR10. The ED50 for this effect is 0.02838 μg/mL, corresponding to a specific activity is 3.524×104 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL27 (L26-N120)
      Accession # NP_035466.1
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    CCL27; CC Chemokine ILC; Prev. SCYA27; Cutaneous T-Cell Attracting Chemokine; CTACK; IL-11 R-Alpha-Locus Chemokine; ILC; IL-11 Ralpha-Locus Chemokine; Skinkine; Small-Inducible Cytokine A27; ESkine; C-C Motif Chemokine 27; PESKY; Cutaneous T-Cell-Attracti

  • AA Sequence

    LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSHPQQQN

  • Predicted Molecular Mass

    10.9 kDa

  • Molecular Weight

    Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00