CTACK/CCL27 Protein, Mouse
Based on 1 Customer Validation
CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.
Background
CCL27 protein acts as a chemotactic factor specifically attracting skin-associated memory T-lymphocytes, potentially playing a crucial role in mediating the homing of lymphocytes to cutaneous sites. This chemokine may also participate in cell migration during embryogenesis. Notably, nuclear forms of CCL27 may contribute to cellular migration by inducing cytoskeletal relaxation. The protein binds to the CCR10 receptor and exists in monomeric, dimeric, and tetrameric forms, with heparin avidly promoting oligomerization. Furthermore, CCL27 interacts with TNFAIP6, specifically via its Link domain.
Verified Bioactivity
Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CCR10. The ED50 for this effect is 0.02838 μg/mL, corresponding to a specific activity is 3.524×104 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Z1X0-1 (L26-N120)
-
Molecular Construction
-
N-term
-
CCL27 (L26-N120)
Accession # NP_035466.1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CCL27; CC Chemokine ILC; Prev. SCYA27; Cutaneous T-Cell Attracting Chemokine; CTACK; IL-11 R-Alpha-Locus Chemokine; ILC; IL-11 Ralpha-Locus Chemokine; Skinkine; Small-Inducible Cytokine A27; ESkine; C-C Motif Chemokine 27; PESKY; Cutaneous T-Cell-Attracti
-
AA Sequence
LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSHPQQQN
-
Predicted Molecular Mass
10.9 kDa
-
Molecular Weight
Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)