CCL6 Protein, Mouse

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

CCL6 Protein, Mouse is a CC chemokine found only in rodents and is associated with macrophage infiltration in chronic inflammation as well as a role in tumorigenesis. CCL6 Protein, Mouse is a recombinant mouse CCL6 (G22-A116) expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CCL6 Protein, Mouse is a CC chemokine found only in rodents and is associated with macrophage infiltration in chronic inflammation as well as a role in tumorigenesis. CCL6 Protein, Mouse is a recombinant mouse CCL6 (G22-A116) expressed by E. coli[1].

Background

CCL6, belongs to the CC family of chemokines is located in mouse chromosome 11. CCL6 can be expressed in cells of the neutrophil and macrophage lineage in mice and can be induced in large numbers under conditions suitable for bone marrow cell differentiation. C10/CCL6 shares significant homology with other chemokines, including human MIP-1γ, CC chemokine F-18 (CCF-18), hemofiltrate CC chemokine (HCC-1), and HCC-2[1].  CCL6 is present in a variety of chronic inflammatory disorders including experimental demyelinating diseases, allergic airway inflammation, bleomycin-induced lung fibrosis and chronic peritonitis. CCL6 also can be used as a monocyte chemoattractant in a murine acute peritonitis[2].

In Vitro

CCL6 (100 -200 ng/mL) can cause concentration-dependent migration of murine ID8 cell lines and can induce migration through activation of ERK and PI3-kinase pathways, thereby enhancing downstream signaling through MYO9A and p-Cofilin[3].

Verified Bioactivity

Full biological activity determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-405 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CCR1. The ED50 for this effect is 404.9 ng/mL, corresponding to a specific activity is 2.470×103 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL6 (G22-A116)
      Accession # P27784
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Ccl6; Small-inducible cytokine A6; C-C motif chemokine 6

  • AA Sequence

    GLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

  • Predicted Molecular Mass

    10.8 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00