CD127/IL-7RA Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-7RA (also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL7 and other alpha helical cytokines. IL-7RA is mainly expressed by cells of the lymphoid lineage. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP). CD127/IL-7RA Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 216 amino acids (E21-G236).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-7RA (also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL7 and other alpha helical cytokines. IL-7RA is mainly expressed by cells of the lymphoid lineage. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP). CD127/IL-7RA Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 216 amino acids (E21-G236)[1][2].

Background

IL-7R α-chain (IL-7RA; also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL-7 and other alpha helical cytokines. IL-7RA is almost exclusively expressed by cells of the lymphoid lineage that plays an important role in lymphocyte differentiation, proliferation, and survival.  IL-7RA gene is localised on chromosome 5p13.3[1][2].
The amino acid sequence of human IL-7RA protein has low homology between mouse and rat IL-7RA protein. While, human IL-7RA shares 97% aa sequence identity with monkey IL-7RA protein.
IL-7 is classified as a type 1 short-chain cytokine of the hematopoietin family. Physiologic roles of IL-7 involve modulation of T- and B-cell development and T-cell homeostasis. To perform all pleiotropic functions of IL-7 in immune system, IL-7 binds through a transmembrane receptor, which is formed by heterodimerizing of the common cytokine gamma chain (γc; also known as CD132) and IL-7RA. IL-7RA consists of an extracellular domain, transmembrane region and cytoplasmic tail, that recruits kinases for signal transduction. IL-7RA is organized in eight exons, spanning 18 kb of genomic DNA. The protein has a folding typical for the insertion of a helical cytokine, and it is composed of an intracellular domain (195 aa), a transmembrane domain (25 aa), and an extracellular region (220 aa). The latter shares homology with other members of the type I family of cytokine receptors. Close to the transmembrane domain, the extracellular region of IL-7Ra contains a Trp-Ser-X-Trp-Ser (WSXWS) motif involved in proper folding of the protein. Finally, the extracellular region also contains two fibronectin type III-like domains. Soluble or membrane-bound isoforms of IL-7RA are produced according to the alternative splicing of exon 6 in IL7RA gene. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP)[1][2][3].
IL-7RA associates with γc to form the functional high affinity IL-7 receptor complex. The natural killer T cells require signals from IL-7RA for their development. The common characteristic of all types of severe combined immunodeficiency (SCID) is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. Defects in IL-7RA may be associated with SCID. Meanwhile, single nucleotide polymorphisms in IL7RA gene are involved in the dysregulation of immune homeostasis and susceptibility to multiple sclerosis (MS). IL-7RA is a receptor for TSLP. TSLP indirectly regulates T cell development by modulating dendritic cell activation[1][3].

In Vitro

Soluble human IL-7RA (0.1 μg/mL, 1 μg/mL, and 10 μg/mL; 3 days) reduces IL-7-mediated proliferation and production of IFN-γ of peripheral blood mononuclear cells (PBMCs)[4].

Verified Bioactivity

1.Recombinant Human CD127/IL-7RA (HY-P72537) immobilized on CM5 Chip can bind Human IL-7 (HY-P7045) with an affinity constant of 17.4 nM as determined in a SPR assay (Biacore 8K).
2.Loaded Crebankitug(HY-P990911) on ProA biosensor, can bind CD127/IL-7RA Protein, Human (HEK293, His) with an affinity constant of 6.831E-09 M as determined in BLI assay.

MCE Validation Data

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Crebankitug(HY-P990911) on ProA biosensor, can bind CD127/IL-7RA Protein, Human (HEK293, His) with an affinity constant of 6.831E-09 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-7RA (E21-G236)
      Accession # P16871-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    IL7R; Soluble Interleukin-7 Receptor; Interleukin 7 Receptor; IL-7 Receptor Subunit Alpha; CDw127; IL-7R Subunit Alpha; Interleukin-7 Receptor Subunit Alpha; CD127 Antigen; IL-7Ralpha; IL-7R-Alpha; IL7Ralpha; Interleukin 7 Receptor Alpha Chain; Lnc-IL7R;

  • AA Sequence

    ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSG

  • Predicted Molecular Mass

    25.7 kDa

  • Molecular Weight

    Approximately 40-55 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00