CD30 Ligand/TNFSF8 Protein, Human (HEK293, N-His)
CD30 ligand/TNFSF8 protein is a cytokine that specifically binds to TNFRSF8/CD30 and acts as a potent inducer of T cell proliferation. As a homotrimer, this ligand plays a crucial role in regulating T cell activation and growth, contributing to the dynamic coordination of immune responses. CD30 Ligand/TNFSF8 Protein, Human (HEK293, N-His) is the recombinant human-derived CD30 Ligand/TNFSF8 protein, expressed by HEK293 , with N-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD30 ligand/TNFSF8 protein is a cytokine that specifically binds to TNFRSF8/CD30 and acts as a potent inducer of T cell proliferation. As a homotrimer, this ligand plays a crucial role in regulating T cell activation and growth, contributing to the dynamic coordination of immune responses. CD30 Ligand/TNFSF8 Protein, Human (HEK293, N-His) is the recombinant human-derived CD30 Ligand/TNFSF8 protein, expressed by HEK293 , with N-6*His labeled tag.
Background
CD30 Ligand/TNFSF8 protein, a cytokine, specifically binds to TNFRSF8/CD30, acting as a potent inducer of T-cell proliferation. Operating as a homotrimer, this ligand plays a crucial role in regulating the activation and growth of T-cells, contributing to the dynamic orchestration of immune responses. The interaction between CD30 Ligand and its receptor, TNFRSF8/CD30, highlights its significance as a molecular trigger for the robust expansion of T-cell populations.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Accession
P32971 (Q63-D234)
-
Molecular Construction
-
N-term
-
6*His
-
CD30L (Q63-D234)
Accession # P32971 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFSF8; CD153 Antigen; Prev. CD30LG; CD30-L; Tumor Necrosis Factor Ligand Superfamily Member 8; CD30L; CD30 Ligand; Tumor Necrosis Factor Superfamily Member 8; CD153; Tumor Necrosis Factor Ligand 3A; Tumor Necrosis Factor (Ligand) Superfamily, Member 8; C
-
AA Sequence
QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
-
Predicted Molecular Mass
21.8 kDa
-
Molecular Weight
Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
