1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins Macrophage CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. LFA-3/CD58
  5. CD58 Protein, Human (HEK293, Fc)

CD58 Protein, Human (HEK293, Fc) is the recombinant human-derived CD58 protein, expressed by HEK293, with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CD58 Protein, Human (HEK293, Fc) is the recombinant human-derived CD58 protein, expressed by HEK293, with C-hFc labeled tag.

Background

CD58, a glycoprotein, also known as lymphocyte-function antigen 3 (LFA-3). CD58 is a costimulatory receptor, and is distributed on various human tissue cells, such as T lymphocytes, NK cells, thymocytes, and a subset of bone marrow cells. CD58 can interact with its natural ligand (CD2, primarily expressed on the surface of T/NK cells). The CD2-CD58 interaction can promote cell adhesion and recognition, and regulate antiviral responses, inflammatory responses in autoimmune diseases, immune rejection of transplantation, and immune evasion of tumor cells[1].
CD58 has two isoforms: a type-I transmembrane form and a glycosylphosphatidylinositol (GPI)-anchored form. The GPI-anchored CD58 form is more effective in enhancing adhesion, but the transmembrane form is more critical for signal transduction. Furthermore, a soluble form of CD58 (sCD58) also exist in cellular supernatant in vitro and in local tissues in vivo. sCD58 is an immunosuppressive factor, and is involved in T/NK cell-mediated immune responses by affecting CD2-CD58 interaction. Altered accumulation of sCD58 may lead to immunosuppression of T/NK cells in the tumor microenvironment. Therefore, sCD58 as a novel immunotherapeutic target[1].

Biological Activity

1. Measured by its binding ability in a functional ELISA. Immobilized human CD2-His at 10 μg/mL (100 μl/well) can bind human CD58-Fc, The EC50 of human CD58-Fc is 0.04-0.1 μg/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD2-His at 10 μg/mL (100 μl/well) can bind human CD58-Fc, The EC50 of human CD58-Fc is 0.04-0.10 μg/mL.
3.Loaded Recombinant Human CD58/LFA-3 Protein, hFc Tag on ProA Biosensor, can bind Recombinant Human CD2 Protein, His Tag with an affinity constant of 1.36 μM as determined in BLI assay.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9BRW0 (F29-R215)

Gene ID

965  [NCBI]

Molecular Construction
N-term
CD58 (F29-R215)
Accession # Q9BRW0
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Lymphocyte Function-Associated Antigen 3; LFA3; Ag3; CD58 antigen
AA Sequence

FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR

분자량

Approximately 68 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD58 Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD58 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75392
수량:
MCE Japan Authorized Agent: