CD58 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
CD58 Protein, Human (HEK293, Fc) is the recombinant human-derived CD58 protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CD58 Protein, Human (HEK293, Fc) is the recombinant human-derived CD58 protein, expressed by HEK293, with C-hFc labeled tag.
Background
CD58, a glycoprotein, also known as lymphocyte-function antigen 3 (LFA-3). CD58 is a costimulatory receptor, and is distributed on various human tissue cells, such as T lymphocytes, NK cells, thymocytes, and a subset of bone marrow cells. CD58 can interact with its natural ligand (CD2, primarily expressed on the surface of T/NK cells). The CD2-CD58 interaction can promote cell adhesion and recognition, and regulate antiviral responses, inflammatory responses in autoimmune diseases, immune rejection of transplantation, and immune evasion of tumor cells[1].
CD58 has two isoforms: a type-I transmembrane form and a glycosylphosphatidylinositol (GPI)-anchored form. The GPI-anchored CD58 form is more effective in enhancing adhesion, but the transmembrane form is more critical for signal transduction. Furthermore, a soluble form of CD58 (sCD58) also exist in cellular supernatant in vitro and in local tissues in vivo. sCD58 is an immunosuppressive factor, and is involved in T/NK cell-mediated immune responses by affecting CD2-CD58 interaction. Altered accumulation of sCD58 may lead to immunosuppression of T/NK cells in the tumor microenvironment. Therefore, sCD58 as a novel immunotherapeutic target[1].
Verified Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized human CD2-His at 10 μg/mL (100 μl/well) can bind human CD58-Fc, The EC50 of human CD58-Fc is 0.04-0.1 μg/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD2-His at 10 μg/mL (100 μl/well) can bind human CD58-Fc, The EC50 of human CD58-Fc is 0.04-0.10 μg/mL.
3.Loaded Recombinant Human CD58/LFA-3 Protein, hFc Tag on ProA Biosensor, can bind Recombinant Human CD2 Protein, His Tag with an affinity constant of 1.36 μM as determined in BLI assay.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9BRW0 (F29-R215)
-
Molecular Construction
-
N-term
-
CD58 (F29-R215)
Accession # Q9BRW0 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD58; Ag3; Prev. LFA3; CD58 Antigen; CD58 Antigen, (Lymphocyte Function-Associated Antigen 3); CD58 Protein; Lymphocyte Function-Associated Antigen 3; LFA-3; Surface Glycoprotein LFA-3; CD58 Molecule; CD58 Antigen, (Lymphocyte Function-Associated Antigen
-
AA Sequence
FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
-
Predicted Molecular Mass
48.5 kDa
-
Molecular Weight
Approximately 68 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)