CDK12-CCNK Heterodimer Protein, Human (Active, sf9, His-GST)

The CDK12 protein is a cyclin-dependent kinase that critically phosphorylates the C-terminal domain of POLR2A, thereby regulating transcription elongation. It selectively targets "Ser-5" phosphorylated at "Ser-7" in the CTD repeat and can also target "Ser-2". CDK12-CCNK Heterodimer Protein, Human (sf9) is a recombinant protein dimer complex containing human-derived CDK12-CCNK Heterodimer protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

The CDK12 protein is a cyclin-dependent kinase that critically phosphorylates the C-terminal domain of POLR2A, thereby regulating transcription elongation. It selectively targets "Ser-5" phosphorylated at "Ser-7" in the CTD repeat and can also target "Ser-2". CDK12-CCNK Heterodimer Protein, Human (sf9) is a recombinant protein dimer complex containing human-derived CDK12-CCNK Heterodimer protein, expressed by sf9 insect cells , with tag free.

Background

The CDK12-CCNK heterodimer protein functions as a cyclin-dependent kinase, playing a crucial role in transcription elongation by phosphorylating the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A). This kinase is a key regulator of gene expression, particularly involved in DNA repair processes and the maintenance of genomic stability. Its phosphorylation activity is selective, preferring 'Ser-5' in CTD repeats already phosphorylated at 'Ser-7,' but it can also target 'Ser-2.' CDK12-CCNK is essential for RNA splicing, potentially through the phosphorylation of SRSF1/SF2. Additionally, it participates in the regulation of MAP kinase activity, suggesting its involvement in influencing responses to estrogen inhibitors.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-6*His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-GST
    • CDK12 (G720-K1080)
      Accession # Q9NYV4-1
    • C-term
    • N-term
    • 6*His-GST
    • CCNK (M1-S300)
      Accession # O75909-1
    • C-term
  • Synonyms

    CDK12; KIAA0904; Prev. CRKRS; Cell Division Cycle 2-Related Protein Kinase 7; CRK7; CDC2-Related Protein Kinase 7; Cdc2-Related Kinase, Arginine/Serine-Rich; CDC2 Related Protein Kinase 7; Cell Division Protein Kinase 12; HCDK12; Cyclin-Dependent Kinase 1

  • AA Sequence

    GKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK&MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS

  • Predicted Molecular Mass

    72 kDa (CDK12) & 65.1 kDa (CyclinK)

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00