1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) CMGC
  4. CDK
  5. CDK12/CRK7
  6. CDK12-CCNK Heterodimer Protein, Human (Active, sf9, His-GST)

CDK12-CCNK Heterodimer Protein, Human (Active, sf9, His-GST)

Cat. No.: HY-P706016
Handling Instructions Technical Support

The CDK12 protein is a cyclin-dependent kinase that critically phosphorylates the C-terminal domain of POLR2A, thereby regulating transcription elongation. It selectively targets "Ser-5" phosphorylated at "Ser-7" in the CTD repeat and can also target "Ser-2". CDK12-CCNK Heterodimer Protein, Human (sf9) is a recombinant protein dimer complex containing human-derived CDK12-CCNK Heterodimer protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CDK12 protein is a cyclin-dependent kinase that critically phosphorylates the C-terminal domain of POLR2A, thereby regulating transcription elongation. It selectively targets "Ser-5" phosphorylated at "Ser-7" in the CTD repeat and can also target "Ser-2". CDK12-CCNK Heterodimer Protein, Human (sf9) is a recombinant protein dimer complex containing human-derived CDK12-CCNK Heterodimer protein, expressed by sf9 insect cells , with tag free.

Background

The CDK12-CCNK heterodimer protein functions as a cyclin-dependent kinase, playing a crucial role in transcription elongation by phosphorylating the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A). This kinase is a key regulator of gene expression, particularly involved in DNA repair processes and the maintenance of genomic stability. Its phosphorylation activity is selective, preferring 'Ser-5' in CTD repeats already phosphorylated at 'Ser-7,' but it can also target 'Ser-2.' CDK12-CCNK is essential for RNA splicing, potentially through the phosphorylation of SRSF1/SF2. Additionally, it participates in the regulation of MAP kinase activity, suggesting its involvement in influencing responses to estrogen inhibitors.

Species

Human

Source

Sf9 insect cells

Tag

N-6*His;N-GST

Accession

Q9NYV4-1 (G720-K1080)&O75909-1 (M1-S300)

Gene ID

51755&8812

Molecular Construction
N-term
6*His-GST
CDK12 (G720-K1080)
Accession # Q9NYV4-1
C-term
N-term
6*His-GST
CCNK (M1-S300)
Accession # O75909-1
C-term
Synonyms
CDK12; CCNK; Cyclin-dependent kinase 12; Cdc2-related kinase; arginine/serine-rich; CrkRS; Cell division cycle 2-related protein kinase 7; CDC2-related protein kinase 7; Cell division protein kinase 12; hCDK12; Cyclin-K
AA Sequence

GKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK&MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS

Predicted Molecular Mass
71.99 kDa (CDK12) & 65.09 kDa (CyclinK)
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Documentation

CDK12-CCNK Heterodimer Protein, Human (Active, sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CDK12-CCNK Heterodimer Protein, Human (Active, sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDK12-CCNK Heterodimer Protein, Human (Active, sf9, His-GST)
Cat. No.:
HY-P706016
Quantity:
MCE Japan Authorized Agent: