CDK12-CCNK Heterodimer Protein, Human (Active, sf9, His-GST)
The CDK12 protein is a cyclin-dependent kinase that critically phosphorylates the C-terminal domain of POLR2A, thereby regulating transcription elongation. It selectively targets "Ser-5" phosphorylated at "Ser-7" in the CTD repeat and can also target "Ser-2". CDK12-CCNK Heterodimer Protein, Human (sf9) is a recombinant protein dimer complex containing human-derived CDK12-CCNK Heterodimer protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
The CDK12 protein is a cyclin-dependent kinase that critically phosphorylates the C-terminal domain of POLR2A, thereby regulating transcription elongation. It selectively targets "Ser-5" phosphorylated at "Ser-7" in the CTD repeat and can also target "Ser-2". CDK12-CCNK Heterodimer Protein, Human (sf9) is a recombinant protein dimer complex containing human-derived CDK12-CCNK Heterodimer protein, expressed by sf9 insect cells , with tag free.
Background
The CDK12-CCNK heterodimer protein functions as a cyclin-dependent kinase, playing a crucial role in transcription elongation by phosphorylating the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A). This kinase is a key regulator of gene expression, particularly involved in DNA repair processes and the maintenance of genomic stability. Its phosphorylation activity is selective, preferring 'Ser-5' in CTD repeats already phosphorylated at 'Ser-7,' but it can also target 'Ser-2.' CDK12-CCNK is essential for RNA splicing, potentially through the phosphorylation of SRSF1/SF2. Additionally, it participates in the regulation of MAP kinase activity, suggesting its involvement in influencing responses to estrogen inhibitors.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-6*His;N-GST
-
Accession
Q9NYV4-1 (G720-K1080)&O75909-1 (M1-S300)
-
Gene ID51755&8812
-
Molecular Construction
-
N-term
-
6*His-GST
-
CDK12 (G720-K1080)
Accession # Q9NYV4-1 -
C-term
-
N-term
-
6*His-GST
-
CCNK (M1-S300)
Accession # O75909-1 -
C-term
-
-
Synonyms
CDK12; KIAA0904; Prev. CRKRS; Cell Division Cycle 2-Related Protein Kinase 7; CRK7; CDC2-Related Protein Kinase 7; Cdc2-Related Kinase, Arginine/Serine-Rich; CDC2 Related Protein Kinase 7; Cell Division Protein Kinase 12; HCDK12; Cyclin-Dependent Kinase 1
-
AA Sequence
GKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK&MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS
-
Predicted Molecular Mass
72 kDa (CDK12) & 65.1 kDa (CyclinK)
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
