Copy Link Print Information

CEACAM5 Protein, Human (HEK293, His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CEACAM5 Protein, Human (HEK293, His)
  • Experimental Validation Results for CEACAM5 Protein, Human (HEK293, His)
  • Experimental Validation Results for CEACAM5 Protein, Human (HEK293, His)
  • CEACAM5 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CEACAM5 protein, a cell surface glycoprotein, assumes a multifaceted role in cell adhesion, intracellular signaling, and tumor progression. Functioning as a mediator of both homophilic and heterophilic cell adhesion, CEACAM5 interacts with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. In the context of tumor progression, CEACAM5 acts as an oncogene, promoting tumor advancement and inducing resistance to anoikis in colorectal carcinoma cells. Additionally, during microbial infection, CEACAM5 serves as a receptor for E. coli Dr adhesins, and the binding of these adhesins results in the dissociation of the CEACAM5 homodimer. These diverse functions underscore the versatility of CEACAM5 in regulating cellular processes and highlight its significance in both physiological and pathological contexts.

Verified Bioactivity

1. Measured by its binding ability in a functional ELISA. Immobilized Galectin-4 protein (HY-P72638) at 2 μg/mL (100 μL/well) can bind CEACAM5. The Kd for this effect is 3.123 nM.
2. Loaded Precemtabart (HY-P990940) on AHC2 biosensor, can bind CEACAM5 Protein, Human (HEK293, His) with an affinity constant of 3.214E-09 M as determined in BLI assay.
3. Loaded Atrosimab (HY-P991049) on ProA biosensor, can bind TNFR-1/CD120a Protein, Human (HEK293, His) with an affinity constant of 2.076E-09 M as determined in BLI assay.

Results

  • Experimental Validation Results for CEACAM5 Protein, Human (HEK293, His)
    Loaded Atrosimab (HY-P991049) on ProA biosensor, can bind TNFR-1/CD120a Protein, Human (HEK293, His) with an affinity constant of 2.076E-09 M as determined in BLI assay.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Galectin-4 protein (HY-P72638) at 2 μg/mL (100 μL/well) can bind CEACAM5. The Kd for this effect is 3.123 nM.

  • Biological Activity

    Biological Activity

    Loaded Atrosimab (HY-P991049) on ProA biosensor, can bind TNFR-1/CD120a Protein, Human (HEK293, His) with an affinity constant of 2.076E-09 M as determined in BLI assay.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Precemtabart (HY-P990940) on AHC2 biosensor, can bind CEACAM5 Protein, Human (HEK293, His) with an affinity constant of 3.214E-09 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P06731-1 (K35-A685)

  • Gene ID
    1048  [NCBI]
  • Molecular Construction
    • N-term
    • CEACAM5 (K35-A685)
      Accession # P06731-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of CEACAM5 Chain

  • Synonyms

    CEACAM5; Cell Adhesion Molecule CEACAM5; Prev. CEA; Meconium Antigen 100; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 Isoform 5D; CD66e; Carcinoembryonic Antigen-Related Cell Adhesio

  • AA Sequence

    KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

  • Molecular Weight

    Approximately 95-150 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • Loaded Atrosimab (HY-P991049) on ProA biosensor, can bind TNFR-1/CD120a Protein, Human (HEK293, His) with an affinity constant of 2.076E-09 M as determined in BLI assay.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Galectin-4 protein (HY-P72638) at 2 μg/mL (100 μL/well) can bind CEACAM5. The Kd for this effect is 3.123 nM.

  • 1/16

    MedChemExpress Validation
     Loaded Atrosimab (HY-P991049) on ProA biosensor, can bind TNFR-1/CD120a Protein, Human (HEK293, His) with an affinity constant of 2.076E-09 M as determined in BLI assay.

  • 1/16

    MedChemExpress Validation
     Loaded Precemtabart (HY-P990940) on AHC2 biosensor, can bind CEACAM5 Protein, Human (HEK293, His) with an affinity constant of 3.214E-09 M as determined in BLI assay.

  • CEACAM5 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CEACAM5 Protein, Human (HEK293, His)
  • Experimental Validation Results for CEACAM5 Protein, Human (HEK293, His)
  • Experimental Validation Results for CEACAM5 Protein, Human (HEK293, His)
  • CEACAM5 Protein, Human (HEK293, His) Product Image