CLEC2B Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
CLEC2B Protein, Human (HEK293, Fc) is the recombinant human-derived CLEC2B protein, expressed by HEK293, with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CLEC2B Protein, Human (HEK293, Fc) is the recombinant human-derived CLEC2B protein, expressed by HEK293, with N-hFc labeled tag.
Background
CLEC2B is a membrane-bound protein expressed on myeloid cells that acts as a ligand to stimulate the activating receptor NKp80/KLRF1, expressed on the surface of natural killer (NK) cells. This interaction stimulates NK-cell cytotoxicity and cytokine production, leading to the cytolysis of malignant CLEC2B-expressing myeloid cells.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human AICL/CLEC-2B is coated at 2 µg/mL can bind Biotinylated Human Galectin-1 (HY-P70273). The ED50 for this effect is 3.87 µg/mL.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q92478 (K26-H149)
-
Gene ID9976 [NCBI]
-
Molecular Construction
-
N-term
-
hFc
-
CLEC2B (K26-H149)
Accession # Q92478 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC2B; IFN-Alpha-2b-Inducing-Related Protein 1; Prev. CLECSF2; Activation-Induced C-Type Lectin; AICL; IFNRG1; HP10085; C-Type Lectin Domain Family 2, Member B; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 2 (Act
-
AA Sequence
KLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIH
-
Predicted Molecular Mass
40 kDa
-
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)