Copy Link Print Information

CLEC5A/MDL-1 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The CLEC5A/MDL-1 protein positively regulates osteoclastogenesis and regulates inflammatory responses. It acts as a critical macrophage receptor for dengue virus serotypes 1-4, triggering signaling through TYROBP phosphorylation. This interaction stimulates the release of pro-inflammatory cytokines without viral entry. CLEC5A/MDL-1 Protein, Human (HEK293, Fc) is the recombinant human-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CLEC5A/MDL-1 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The CLEC5A/MDL-1 protein positively regulates osteoclastogenesis and regulates inflammatory responses. It acts as a critical macrophage receptor for dengue virus serotypes 1-4, triggering signaling through TYROBP phosphorylation. This interaction stimulates the release of pro-inflammatory cytokines without viral entry. CLEC5A/MDL-1 Protein, Human (HEK293, Fc) is the recombinant human-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CLEC5A/MDL-1 functions as a positive regulator of osteoclastogenesis and serves as a cell surface receptor that signals through TYROBP, thereby modulating inflammatory responses. In the context of microbial infection, particularly as a critical macrophage receptor for dengue virus serotypes 1-4, CLEC5A plays a crucial role. The interaction between dengue virus and CLEC5A leads to signaling events involving the phosphorylation of TYROBP, which, interestingly, does not facilitate viral entry but rather induces the release of pro-inflammatory cytokines.

Verified Bioactivity

Immobilized Human MDL-1,hFc Tag at 2 ug/ml (100 ul/well)on the plate.Dose response curve for Biotinylated Anti-MDL-1 Antibody, hFc Tag with the EC50 < 17.8 ng/ml determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession

    Q9NY25 (Y26-K188)

  • Gene ID
    23601  [NCBI]
  • Molecular Construction
    • N-term
    • hFc
    • CLEC5A/MDL-1 (Y26-K188)
      Accession # Q9NY25
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC5A; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 5; Prev. CLECSF5; MDL1; C-Type Lectin Domain Family 5 Member A; C-Type Lectin Domain Family 5, Member A; MDL-1; Myeloid DAP12-Associating Lectin-1; C-Type Lecti

  • AA Sequence

    YFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK

  • Predicted Molecular Mass

    46 kDa

  • Molecular Weight

    Approximately 63-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CLEC5A/MDL-1 Protein, Human (HEK293, Fc) Product Image
    1/16
  • CLEC5A/MDL-1 Protein, Human (HEK293, Fc) Product Image