CLEC5A/MDL-1 Protein, Human (HEK293, Fc)

The CLEC5A/MDL-1 protein positively regulates osteoclastogenesis and regulates inflammatory responses. It acts as a critical macrophage receptor for dengue virus serotypes 1-4, triggering signaling through TYROBP phosphorylation. This interaction stimulates the release of pro-inflammatory cytokines without viral entry. CLEC5A/MDL-1 Protein, Human (HEK293, Fc) is the recombinant human-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-hFc labeled tag.

CLEC5A/MDL-1 functions as a positive regulator of osteoclastogenesis and serves as a cell surface receptor that signals through TYROBP, thereby modulating inflammatory responses. In the context of microbial infection, particularly as a critical macrophage receptor for dengue virus serotypes 1-4, CLEC5A plays a crucial role. The interaction between dengue virus and CLEC5A leads to signaling events involving the phosphorylation of TYROBP, which, interestingly, does not facilitate viral entry but rather induces the release of pro-inflammatory cytokines.

Immobilized Human MDL-1,hFc Tag at 2 ug/ml (100 ul/well)on the plate.Dose response curve for Biotinylated Anti-MDL-1 Antibody, hFc Tag with the EC₅₀ < 17.8 ng/ml determined by ELISA.

Human

HEK293

N-hFc

Q9NY25 (Y26-K188)

23601  [NCBI]

Partial

YFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK

63-70 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.