Copy Link Print Information

Complement C3a Protein, Mouse

8 Cited Publications
Customer Review

Based on 8 publication(s) in Google Scholar

Complement C3/C3a protein activates the complement system, playing a central role in both classical and alternative pathways. C3b binds covalently to cell surface carbohydrates or immune aggregates, while C3a acts as an inflammatory mediator, inducing neutrophil chemoattraction and promoting smooth muscle contraction, increased vascular permeability, and histamine release. The shorter isoform of C3a stimulates B-cells. Complement C3a Protein, Mouse is the recombinant mouse-derived Complement C3/C3a protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Complement C3a Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Complement C3/C3a protein activates the complement system, playing a central role in both classical and alternative pathways. C3b binds covalently to cell surface carbohydrates or immune aggregates, while C3a acts as an inflammatory mediator, inducing neutrophil chemoattraction and promoting smooth muscle contraction, increased vascular permeability, and histamine release. The shorter isoform of C3a stimulates B-cells. Complement C3a Protein, Mouse is the recombinant mouse-derived Complement C3/C3a protein, expressed by E. coli , with tag free.

Background

Complement C3/C3a protein plays a pivotal role in the activation of the complement system, being the central reaction in both classical and alternative pathways. Following activation, C3b can bind covalently to cell surface carbohydrates or immune aggregates through its reactive thioester. C3a, derived from the proteolytic degradation of complement C3, acts as a local inflammatory mediator, inducing neutrophil chemoattraction and promoting smooth muscle contraction, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. Additionally, the shorter isoform of C3a exhibits B-cell stimulatory activity.

In Vitro

Complement C3/C3a Protein, Mouse (0-500 ng/mL, 48 h) enhances the expression of C3aR in Panc-02 cell, induces the activation of C3a/C3aR signaling pathway, thereby promoting the proliferation and migration ability of Panc-02 cell, and reducing its sensitivity to Gemcitabine (HY-17026)[1].
Complement C3/C3a Protein, Mouse (10 µg/mL, 1 h) enhances the phagocytosis of mouse primary microglia cells[2].
Complement C3/C3a Protein, Mouse (100 nM, 24-72 h) upregulates the expression of LC3B, downregulates the expression of p62, promotes podocyte autophagy under high glucose conditions in MPC-5 cell[3].

Verified Bioactivity

Measured by its ability to enhance IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.4-3.0 μg/mL.

Results
  • Experimental Validation Results for Complement C3a Protein, Mouse
    Measured by its ability to enhance IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.5190 μg/mL, corresponding to a specific activity is 1926.7823 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P01027-1 (S671-R748)

  • Gene ID
    12266  [NCBI]
  • Molecular Construction
    • N-term
    • C3a (S671-R748)
      Accession # P01027
    • C-term
  • Protein Length

    Full Length of C3a anaphylatoxin

  • Synonyms

    rMuComplement C3/C3a; Complement Component C3a; Anaphylatoxin; C3a

  • AA Sequence

    SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR

  • Predicted Molecular Mass

    9.2 kDa

  • Molecular Weight

    Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for Complement C3a Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Shi S, et al., The complement C3a/C3aR pathway is associated with treatment resistance to gemcitabine-based neoadjuvant therapy in pancreatic cancer. Comput Struct Biotechnol J. 2024 Oct 5;23:3634-3650. [Content Brief]

[2]. Li S, et al., Microglia mediate memory dysfunction via excitatory synaptic elimination in a fracture surgery mouse model. J Neuroinflammation. 2024 Sep 16;21(1):227. [Content Brief]

[3]. Zhang L, et al., C-reactive protein inhibits C3a/C3aR-dependent podocyte autophagy in favor of diabetic kidney disease. FASEB J. 2022 Jun;36(6):e22332. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured by its ability to enhance IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.5190 μg/mL, corresponding to a specific activity is 1926.7823 U/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to enhance IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.5190 μg/mL, corresponding to a specific activity is 1926.7823 U/mg.

  • 1/16

    Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Neuroinflammation. 2025 Mar 7;22(1):69. [Abstract]

    Customer Validation
     Complement C3 (0.05, 0.5, and 5 µg/mL for 6 h) increased C1qa concentration in the medium of BV2 cells in a dose-dependent manner.

  • 1/16

    Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Biochem Pharmacol. 2025 Oct 13:117421. [Abstract]

    Customer Validation
     Western blot analysis of VSMC phenotypic markers in MOVAS cells following 10 ng/mL C3a stimulation for 6 h, showing downregulation of contractile proteins SM22α and Calponin, and upregulation of the synthetic marker MMP9 (n = 9).

  • 1/16

    Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Biochem Pharmacol. 2025 Oct 13:117421. [Abstract]

    Customer Validation
     Schematic diagram, representative images, and quantitative analysis of Transwell migration assays. RAW 264.7 macrophages were seeded in the upper chamber, with or without the C3a receptor antagonist (C3aRa), while the lower chamber contained either MOVAS cells or medium alone supplemented with 10 ng/mL C3a. After 48 hours, migrated macrophages were fixed, stained, and quantified (n = 3).

  • 1/16

    Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Biochem Pharmacol. 2025 Oct 13:117421. [Abstract]

    Customer Validation
     Quantitative RT-PCR validation of representative cytokine-related genes in MOVAS cells following C3a (10 ng/mL, 6 hours) treatment (n = 6).

  • 1/16

    Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Neuroinflammation. 2024 Sep 16;21(1):227. [Abstract]

    Customer Validation
     Complement C3 treatment (10 µg/mL, 1 h) enhanced phagocytic capability, reflected by increased colocalization of fluorescent latex beads with microglia.

  • 1/16

    Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Customer Validation
     Quantitative RT-PCR analysis of LC3B and p62 expression under low-glucose and high-glucose conditions with C3a and C5a treatment (both 100 nM, 24 h; n = 3).

  • 1/16

    Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Customer Validation
     Western blot and quantitative analysis of LC3B and p62 expression under high-glucose conditions with C5a treatment (100 nM, 48 h; n = 4).

  • 1/16

    Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Customer Validation
     Representative images of autophagy flux changes with C3a and C5a treatment (both 100 nM, 48 h; n = 3). 600× original magnification; scale bar, 10 µm. Data are presented as the means ± SEM, p < 0.05 was considered to be statistically significant.

  • Complement C3a Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Experimental Validation Results for Complement C3a Protein, Mouse
  • Complement C3a Protein, Mouse Product Image

  • Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Neuroinflammation. 2025 Mar 7;22(1):69. [Abstract]

    Complement C3 (0.05, 0.5, and 5 µg/mL for 6 h) increased C1qa concentration in the medium of BV2 cells in a dose-dependent manner.

  • Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Biochem Pharmacol. 2025 Oct 13:117421. [Abstract]

    Western blot analysis of VSMC phenotypic markers in MOVAS cells following 10 ng/mL C3a stimulation for 6 h, showing downregulation of contractile proteins SM22α and Calponin, and upregulation of the synthetic marker MMP9 (n = 9).

  • Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Biochem Pharmacol. 2025 Oct 13:117421. [Abstract]

    Schematic diagram, representative images, and quantitative analysis of Transwell migration assays. RAW 264.7 macrophages were seeded in the upper chamber, with or without the C3a receptor antagonist (C3aRa), while the lower chamber contained either MOVAS cells or medium alone supplemented with 10 ng/mL C3a. After 48 hours, migrated macrophages were fixed, stained, and quantified (n = 3).

  • Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Biochem Pharmacol. 2025 Oct 13:117421. [Abstract]

    Quantitative RT-PCR validation of representative cytokine-related genes in MOVAS cells following C3a (10 ng/mL, 6 hours) treatment (n = 6).

  • Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Neuroinflammation. 2024 Sep 16;21(1):227. [Abstract]

    Complement C3 treatment (10 µg/mL, 1 h) enhanced phagocytic capability, reflected by increased colocalization of fluorescent latex beads with microglia.

  • Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Quantitative RT-PCR analysis of LC3B and p62 expression under low-glucose and high-glucose conditions with C3a and C5a treatment (both 100 nM, 24 h; n = 3).

  • Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Western blot and quantitative analysis of LC3B and p62 expression under high-glucose conditions with C5a treatment (100 nM, 48 h; n = 4).

  • Complement C3a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Representative images of autophagy flux changes with C3a and C5a treatment (both 100 nM, 48 h; n = 3). 600× original magnification; scale bar, 10 µm. Data are presented as the means ± SEM, p < 0.05 was considered to be statistically significant.