Complement C5a Protein, Human
Based on 1 publication(s) in Google Scholar
Complement C5/C5a Protein, Human is a recombinant human complement C5a. C5a is a 74-amino acid glycoprotein generated on activation of the C system. Complement C5 is cleaved by proteolysis in the terminal phase of complement activation generating the pro-inflammatory C5a and membrane attack complex nucleator C5b. C5a is an inflammatory mediator generated by complement activation that positively regulates various arms of immune defense, including Toll-like receptor 4 (TLR4) signaling. Complement C5a Protein, Human is a human-derived recombinant protein that expressed by E. coli.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Complement C5/C5a Protein, Human is a recombinant human complement C5a. C5a is a 74-amino acid glycoprotein generated on activation of the C system. Complement C5 is cleaved by proteolysis in the terminal phase of complement activation generating the pro-inflammatory C5a and membrane attack complex nucleator C5b. C5a is an inflammatory mediator generated by complement activation that positively regulates various arms of immune defense, including Toll-like receptor 4 (TLR4) signaling. Complement C5a Protein, Human is a human-derived recombinant protein that expressed by E. coli[1][2].
Complement component 5a (C5a) is a 74 amino acid glycoprotein and an important proinflammatory mediator that is cleaved enzymatically from its precursor, C5, on activation of the complement cascade. C5a is quickly metabolised by carboxypeptidases, forming the less-potent C5a desArg. C5a and C5a desArg interact with their receptors (C5aR and C5L2), which results in a number of effects which are essential to the immune response. C5a has a broad range of biological effects throughout the human body because the widespread expression of C5a receptors throughout the human organs enables C5a and C5a desArg to elicit a broad range of biological effects[2].
Complement C5/C5a Protein, Human (5 nM, 4 h) promotes the release of neutrophil extracellular traps (NETs) in human peripheral blood neutrophils with stronger fibrous and network-like structures[3].
1.Immobilized C5a at 2 μg/mL (100 μL/well) can bind anti-C5a. The ED50 is 41.72 ng/mL, corresponding to a specific activity is 2.39×104 units/mg.
2.Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED50 for this effect is 3.332-4.647 ng/mL, corresponding to a specific activity is 2.151-3.001×105 units/mg.
-
Immobilized C5a at 2 μg/mL (100 μL/well) can bind anti-C5a, The ED50 for this effect is 41.72 ng/mL, corresponding to a specific activity is 2.39×104 units/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Adv Healthc Mater
Targeted Delivery of Avacopan via Sortase A-Modified Extracellular Vesicles Attenuates Endotoxin-Induced Retinal Inflammation. [Abstract]2026 Jan 24:e04723. PMID: 41580904
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P01031 (T678-R751)
-
Molecular Construction
-
N-term
-
C5a (T678-R751)
Accession # P01031 -
C-term
-
-
Protein Length
Partial
-
Synonyms
rHuComplement C5/C5a; Complement C5; C5a anaphylatoxin; C5a
-
AA Sequence
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
-
Molecular Weight
Approximately 10-12 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. An G, et al. Role of C5a-C5aR axis in the development of atherosclerosis. Sci China Life Sci. 2014;57(8):790-794. [Content Brief]
[2]. Haggadone MD, et al. Bidirectional Crosstalk between C5a Receptors and the NLRP3 Inflammasome in Macrophages and Monocytes. Mediators Inflamm. 2016;2016:1340156. [Content Brief]
[3]. Li Z, et al., Neutrophil extracellular traps potentiate effector T cells via endothelial senescence in uveitis. JCI Insight. 2025 Jan 23;10(2):e180248. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
