CTRB1 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

CTRB1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTRB1 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CTRB1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTRB1 protein, expressed by HEK293, with C-His labeled tag.

Background

Chymotrypsinogen B (CTRB1) is a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. CTRB1 is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate the functional enzyme. CTRB1 enables serine-type endopeptidase activity, being involved in response to apoptotic signal, nutrient, cytokine and peptide hormone. CTRB1 induces apoptosis through Bid cleavage activity, as the truncated Bid can in turn cause rapid mitochondrial release of cytochrome c. CTRB1 is located in lysosome and is a biomarker of pancreatitis. CTRB1 gene encodes distinct isoforms, which may undergo similar processing to generate the mature protein[1][2][3][4][5].

Verified Bioactivity

Measured by its ability to cleave a peptide substrate, Suc-AAPF-pNA. Read at OD 410 nm. The specific activity is 969.68 pmol/min/mg, as measured under the described conditions.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CTRB1 (M1-N263)
      Accession # P07338
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CTRB1; Chymotrypsinogen B; Prev. CTRB; Chymotrypsinogen B1; Chymotrypsin

  • AA Sequence

    CGVPTIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPAVYSRVTALMPWVQQILEAN

  • Molecular Weight

    Approximately 27 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00