CTRB1 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CTRB1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTRB1 protein, expressed by HEK293, with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CTRB1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTRB1 protein, expressed by HEK293, with C-His labeled tag.
Background
Chymotrypsinogen B (CTRB1) is a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. CTRB1 is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate the functional enzyme. CTRB1 enables serine-type endopeptidase activity, being involved in response to apoptotic signal, nutrient, cytokine and peptide hormone. CTRB1 induces apoptosis through Bid cleavage activity, as the truncated Bid can in turn cause rapid mitochondrial release of cytochrome c. CTRB1 is located in lysosome and is a biomarker of pancreatitis. CTRB1 gene encodes distinct isoforms, which may undergo similar processing to generate the mature protein[1][2][3][4][5].
Verified Bioactivity
Measured by its ability to cleave a peptide substrate, Suc-AAPF-pNA. Read at OD 410 nm. The specific activity is 969.68 pmol/min/mg, as measured under the described conditions.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
P07338 (C19-N263)
-
Molecular Construction
-
N-term
-
CTRB1 (M1-N263)
Accession # P07338 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CTRB1; Chymotrypsinogen B; Prev. CTRB; Chymotrypsinogen B1; Chymotrypsin
-
AA Sequence
CGVPTIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPAVYSRVTALMPWVQQILEAN
-
Molecular Weight
Approximately 27 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)