CXCL16 Protein, Canine (HEK293, His)

Customer Review

Based on 1 Customer Validation

CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types. CXCL16 Protein, Canine (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 205 amino acids (M1-S205).

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Canine (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 205 amino acids (M1-S205).

Background

CXCL16 is a membrane-bound chemokine. CXCL16 is expressed in soluble or transmembrane forms and can be observed in many cell types, including inflammatory cells (such as macrophages, neutrophils, dendritic cells and monocytes) and non-inflammatory cells (such as lung epithelial cells and renal cells). CXCL16 plays important roles both in the natural immune barrier and in the occurrence and development of autoimmune diseases[1][2].
The amino acid sequence of human CXCL16 protein has low homology between mouse, rat and dog CXCL16 protein.
CXCL16 is primarily expressed on the surface of antigen-presenting cells (APCs) and consists of a chemokine domain (∼89 amino acids), a mucin-type stalk (∼110 amino acids), a single-pass transmembrane domain (∼20 amino acids), and a cytoplasmic tail (∼27 amino acids). CXCL16 is the only ligand of the CXCR6 receptor. Soluble CXCL16 induces the migration of CXCR6+ cells (including Th1 cells, NK cells and activated CD8 + T-cells), M2-macrophage infiltration, interactions between APC and CD8 + T-cells, the cellular immune response and inflammatory response, and the development of thymocytes. Membrane-bound CXCL16 can promote the adhesion of CXCR6+ cells. CXCL16 specifically binds oxidized low-density lipoprotein (OxLDL), leading to its internalization and degradation. CXCL16 may play important roles in the formation of atherosclerotic lesions. CXCL16 on macrophages and dendritic cells mediates the adhesion and phagocytosis of bacteria, such as Escherichia coli and Staphylococcus aureus, and bacterial recognition is mediated by the chemokine domain of CXCL16[1][2].
CXCL16 is not only a chemokine, but is also a multifunctional protein. CXCL16 and CXCR6 are related to various inflammatory diseases, such as glomerulonephritis, pulmonary diseases, atherosclerosis, coronary artery disease, rheumatoid arthritis and many inflammation-related cancers. The chemokine domain of CXCL16 exerts potent anti-microbial activities against E. coli and S. aureus. CXCL16 acts as a mediator of innate immunity by attracting CXCR6-expressing cells, such as activated T cells and NKT cells. CXCL16 is also a novel mediator of the innate immune reactivities of keratinocytes in the human epidermis[1][2][3].

Verified Bioactivity

Determined by its ability to chemoattract activated Jurkat cells. The ED50 for this effect is 0.9798 ng/mL, corresponding to a specific activity is 1.021×106 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Determined by its ability to chemoattract activated Jurkat cells. The ED50 for this effect is 0.9798 ng/mL, corresponding to a specific activity is 1.021×106 U/mg.

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXCL16 (N22-S205)
      Accession # XP_849304
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CXCL16; CXCLG16; C-X-C Motif Chemokine Ligand 16; Scavenger Receptor For Phosphatidylserine And Oxidized Low Density Lipoprotein; SR-PSOX; Chemokine (C-X-C Motif) Ligand 16; SRPSOX; Small-Inducible Cytokine B16; Transmembrane Chemokine CXCL16; CXC Chemoki

  • AA Sequence

    NEGSVTGSCYCDKAISSGSPPTAELMAHLRKHLRVYQRCNSYVRFQLRMRSVCGGSKDPWVQQLMSCLDRKECGSADSRSVAPQEQLPPLSTQVPEPTERAPLDMGSPAQTYLPPAWRSTYLPTALQSTRQPVFPAGTLSLEKKLTHTSEIATSTVGHSLRTGSEAGESQKQQIKRVEPTAGTS

  • Predicted Molecular Mass

    20.1 kDa

  • Molecular Weight

    Approximately 30-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00