Cystatin D/CST5 Protein, Human (HEK293, His)

Cystatin D (CST5), a cysteine proteinase inhibitor, potentially safeguards against oral cavity proteinases. Exhibiting specificity, it preferentially inhibits cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This nuanced regulation emphasizes Cystatin D's role in modulating specific cysteine proteinases, signifying its importance in proteostasis and potential involvement in oral health. Cystatin D/CST5 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin D/CST5 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Cystatin D (CST5), a cysteine proteinase inhibitor, potentially safeguards against oral cavity proteinases. Exhibiting specificity, it preferentially inhibits cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This nuanced regulation emphasizes Cystatin D's role in modulating specific cysteine proteinases, signifying its importance in proteostasis and potential involvement in oral health. Cystatin D/CST5 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin D/CST5 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Cystatin D (CST5), a cysteine proteinase inhibitor, is believed to serve a potential protective function against proteinases found in the oral cavity. Exhibiting specificity in its inhibitory activity, Cystatin D shows a preference order for inhibition against cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This suggests a nuanced regulatory role of Cystatin D in modulating the activities of specific cysteine proteinases, highlighting its significance in maintaining proteostasis and potential involvement in oral health.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CST5 (G21-V142)
      Accession # P28325
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CST5; Cysteine-Proteinase Inhibitor; Cystatin D; Cystatin 5; Cystatin-D; Cystatin-5

  • AA Sequence

    GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV

  • Predicted Molecular Mass

    14.9 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00