Cystatin D/CST5 Protein, Human (HEK293, His)
Cystatin D (CST5), a cysteine proteinase inhibitor, potentially safeguards against oral cavity proteinases. Exhibiting specificity, it preferentially inhibits cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This nuanced regulation emphasizes Cystatin D's role in modulating specific cysteine proteinases, signifying its importance in proteostasis and potential involvement in oral health. Cystatin D/CST5 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin D/CST5 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cystatin D (CST5), a cysteine proteinase inhibitor, potentially safeguards against oral cavity proteinases. Exhibiting specificity, it preferentially inhibits cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This nuanced regulation emphasizes Cystatin D's role in modulating specific cysteine proteinases, signifying its importance in proteostasis and potential involvement in oral health. Cystatin D/CST5 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin D/CST5 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Cystatin D (CST5), a cysteine proteinase inhibitor, is believed to serve a potential protective function against proteinases found in the oral cavity. Exhibiting specificity in its inhibitory activity, Cystatin D shows a preference order for inhibition against cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This suggests a nuanced regulatory role of Cystatin D in modulating the activities of specific cysteine proteinases, highlighting its significance in maintaining proteostasis and potential involvement in oral health.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P28325 (G21-V142)
-
Molecular Construction
-
N-term
-
CST5 (G21-V142)
Accession # P28325 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CST5; Cysteine-Proteinase Inhibitor; Cystatin D; Cystatin 5; Cystatin-D; Cystatin-5
-
AA Sequence
GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
-
Predicted Molecular Mass
14.9 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
