EphA3 Protein, Mouse (sf9)
The EphA3 protein is a receptor tyrosine kinase that promiscuously binds to membrane-bound ephrin ligands to initiate bidirectional signaling. Activation of EphA3 is known to preferentially bind to EFNA5 and regulates cell-cell adhesion, cytoskeletal organization, and migration. EphA3 Protein, Mouse (sf9) is the recombinant mouse-derived EphA3 protein, expressed by Sf9 insect cells , with tag free.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The EphA3 protein is a receptor tyrosine kinase that promiscuously binds to membrane-bound ephrin ligands to initiate bidirectional signaling. Activation of EphA3 is known to preferentially bind to EFNA5 and regulates cell-cell adhesion, cytoskeletal organization, and migration. EphA3 Protein, Mouse (sf9) is the recombinant mouse-derived EphA3 protein, expressed by Sf9 insect cells , with tag free.
The EphA3 protein, a receptor tyrosine kinase, engages in promiscuous binding to membrane-bound ephrin family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the pathway downstream of the ephrin ligand is termed reverse signaling. Highly promiscuous for ephrin-A ligands, EphA3 exhibits a preferential binding affinity for EFNA5. Upon activation by EFNA5, EphA3 plays a pivotal role in regulating cell-cell adhesion, cytoskeletal organization, and cell migration. Additionally, EphA3 is implicated in cardiac cell migration and differentiation, regulating the formation of the atrioventricular canal and septum during development, likely through activation by EFNA1. In the context of retinotectal mapping, EphA3 is involved in the guidance of neurons. Furthermore, EphA3 may control the segregation, though not the guidance, of motor and sensory axons during neuromuscular circuit development.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q8BRB1 (G569-V984)
-
Molecular Construction
-
N-term
-
EphA3 (G569-V984)
Accession # Q8BRB1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
EPHA3; Tyrosine-Protein Kinase TYRO4; Prev. TYRO4; EK4; Prev. ETK1; Receptor Protein-Tyrosine Kinase; Prev. ETK; Ephrin Type-A Receptor 3 Variant; HEK4; Testicular Tissue Protein Li 64; HEK; TYRO4 Protein Tyrosine Kinase; Ephrin Type-A Receptor 3; Human E
-
AA Sequence
GYHKSKHSAEEKRLHFGNGHLKLPGLRTYVDPHTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDIATFHTTGDWLNGMRTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKIISTIKALETQSKNGPVPV
-
Predicted Molecular Mass
46.6 kDa
-
Molecular Weight
Approximately 44 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)