EphA6 Protein, Human (CHO, Fc)
EphA6 Protein, a receptor tyrosine kinase, engages in promiscuous binding with GPI-anchored ephrin-A ligands, facilitating contact-dependent bidirectional signaling. EphA6 mediates intricate signaling exchanges between cells, playing a crucial role in diverse cellular processes through both forward and reverse signaling pathways. EphA6 Protein, Human (CHO, Fc) is the recombinant human-derived EphA6 protein, expressed by CHO , with C-hFc labeled tag.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
EphA6 Protein, a receptor tyrosine kinase, engages in promiscuous binding with GPI-anchored ephrin-A ligands, facilitating contact-dependent bidirectional signaling. EphA6 mediates intricate signaling exchanges between cells, playing a crucial role in diverse cellular processes through both forward and reverse signaling pathways. EphA6 Protein, Human (CHO, Fc) is the recombinant human-derived EphA6 protein, expressed by CHO , with C-hFc labeled tag.
The EphA6 protein, a receptor tyrosine kinase, exhibits promiscuous binding to GPI-anchored ephrin-A family ligands on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. The downstream pathway originating from the receptor is termed forward signaling, while the pathway downstream of the ephrin ligand is referred to as reverse signaling, as indicated by similarity to other Eph receptors. This interaction highlights EphA6's role in mediating intricate signaling exchanges between cells, contributing to diverse cellular processes through bidirectional communication.
Technical Parameters
-
Species Human
-
Source CHO
-
Tag C-hFc
-
Accession
Q9UF33-1/AAI56734.1 (W23-V550)
-
Molecular Construction
-
N-term
-
EphA6 (W23-V550)
Accession # Q9UF33-1/AAI56734.1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
EPHA6; HEK12; EPH Receptor A6; EHK2; Ephrin Type-A Receptor 6; EK12; EPH Homology Kinase 2; Receptor Protein-Tyrosine Kinase; EPH-Like Kinase 12; Ephrin Receptor EphA6; FLJ35246; PRO57066; EHK-2; EPA6
-
AA Sequence
WPGDCSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLFYMESDESHGIKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLIGVVRKDWASQNSIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQILV
-
Molecular Weight
Approximately 95-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
