Ephrin-B1/EFNB1 Protein, Mouse (HEK293, His)
Ephrin-B1/EFNB1 proteins are cell surface ligands of Eph receptors that critically regulate migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Ephrin-B1/EFNB1 proteins are cell surface ligands of Eph receptors that critically regulate migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-His labeled tag.
Background
Ephrin-B1/EFNB1, a cell surface transmembrane ligand for Eph receptors, plays a pivotal role in mediating contact-dependent bidirectional signaling during neuronal, vascular, and epithelial development. With high affinity for the receptor tyrosine kinase EPHB1/ELK, it also binds to EPHB2 and EPHB3. Binding to Eph receptors on neighboring cells initiates bidirectional signaling crucial for migration, repulsion, and adhesion. Additionally, EFNB1 is involved in inducing the collapse of commissural axons/growth cones in vitro and may contribute to constraining the orientation of longitudinally projecting axons. The protein interacts with GRIP1 and GRIP2 through its PDZ-binding motif and associates with TLE1. Moreover, the intracellular domain peptide of EFNB1 interacts with ZHX2, enhancing ZHX2's transcriptional repression activity.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P52795/NP_034240.1 (K30-S229)
-
Molecular Construction
-
N-term
-
EFNB1 (K30-S229)
Accession # P52795/NP_034240.1 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
EFNB1; ELK Ligand; Prev. EPLG2; Craniofrontonasal Syndrome (Craniofrontonasal Dysplasia); Prev. CFNS; LERK-2; LERK2; ELK-L; EPH-Related Receptor Tyrosine Kinase Ligand 2; EFL-3; Ephrin-B1; CFND; Elk-L; EFB1; Ephrin B1; EFL3
-
AA Sequence
KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS
-
Predicted Molecular Mass
23.3 kDa
-
Molecular Weight
Approximately 33-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
