Erythropoietin/EPO Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
Erythropoietin/EPO Protein, Human (HEK293, Fc) is the recombinant human-derived Erythropoietin/EPO protein, expressed by HEK293, with C-hFc tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Erythropoietin/EPO Protein, Human (HEK293, Fc) is the recombinant human-derived Erythropoietin/EPO protein, expressed by HEK293, with C-hFc tag.
Background
EPO is a hormone involved in regulating erythrocyte proliferation and differentiation and maintaining a physiological level of circulating erythrocyte mass. It binds to EPOR, leading to EPOR dimerization and JAK2 activation, thereby activating specific downstream effectors, including STAT1 and STAT3. by similar: These functions have been validated in related studies.
Verified Bioactivity
1.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 8 ng/mL.
2.Immobilized Recombinant Human EPO Receptor / EPOR Protein (ECD, His Tag) at 2 μg/mL (100 μL/well) can bind Recombinant Human Erythropoietin / EPO Protein (Fc Tag), the EC50 is 5-15 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P01588 (A28-R193)
-
Gene ID2056
-
Protein Length
Full Length of Mature Protein
-
Synonyms
EPO; ECYT5; Erythropoietin; MVCD2; EP; DBAL; Epoetin
-
AA Sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
-
Predicted Molecular Mass
45.1 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
