Erythropoietin/EPO Protein, Human (HEK293, Fc)

Erythropoietin/EPO Protein, Human (HEK293, Fc) is the recombinant human-derived Erythropoietin/EPO protein, expressed by HEK293, with C-hFc tag.

EPO is a hormone involved in regulating erythrocyte proliferation and differentiation and maintaining a physiological level of circulating erythrocyte mass. It binds to EPOR, leading to EPOR dimerization and JAK2 activation, thereby activating specific downstream effectors, including STAT1 and STAT3. by similar: These functions have been validated in related studies.

1.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 8 ng/mL.
2.Immobilized Recombinant Human EPO Receptor / EPOR Protein (ECD, His Tag) at 2 μg/mL (100 μL/well) can bind Recombinant Human Erythropoietin / EPO Protein (Fc Tag), the EC₅₀ is 5-15 ng/mL.

Human

HEK293

C-hFc

P01588 (A28-R193)

2056

Full Length of Mature Protein

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.