Erythropoietin Protein, Rat (sf9, His)
Epo protein is a hormone that plays a vital role in regulating red blood cell production in the body.It stimulates the differentiation and maturation of red blood cells in the bone marrow.Erythropoietin Protein, Rat (sf9, His) is the recombinant rat-derived Erythropoietin protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Rat
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Epo protein is a hormone that plays a vital role in regulating red blood cell production in the body.It stimulates the differentiation and maturation of red blood cells in the bone marrow.Erythropoietin Protein, Rat (sf9, His) is the recombinant rat-derived Erythropoietin protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Epo Protein is a hormone primarily responsible for regulating the proliferation and differentiation of erythrocytes, as well as maintaining a balanced level of circulating erythrocyte mass. It accomplishes this by binding to its receptor, EPOR, which leads to the dimerization of EPOR and subsequent activation of JAK2. This activation triggers a cascade of signaling events involving specific downstream effectors such as STAT1 and STAT3. These pathways, including the RAS-MAPK and JAK-STAT5 pathways, contribute to the diverse functions of Epo Protein. Additionally, Epo Protein exists as a homodimer connected by disulfide bonds.
Technical Parameters
-
Species Rat
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P29676-1 (A27-R192)
-
Molecular Construction
-
N-term
-
Erythropoietin (A27-R192)
Accession # P29676-1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
EPO; ECYT5; Erythropoietin; MVCD2; EP; DBAL; Epoetin
-
AA Sequence
APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
