Copy Link Print Information

KGF-2/FGF-10 Protein, Mouse

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

KGF-2/FGF-10 Protein, Mouse is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Mouse
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Mouse
  • KGF-2/FGF-10 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KGF-2/FGF-10 Protein, Mouse is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands.

Background

Mature mouse Fibroblast Growth Factor-10 (FGF10) shares 94% and 100% amino acid sequence identity with human and rat FGF10, respectively. The mitogenic and chemotactic properties of FGF10 are critical in many tissues during embryogenesis. FGF10 induces signaling through FGF R2 (IIIb) also contributes to the progression of pancreatic cancer[1]. FGF10 is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands[2].

Verified Bioactivity

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 this effect is <85 ng/mL, corresponding to a specific activity is >1.0 × 104 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    O35565 (S62-T209)

  • Gene ID
    14165  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-10 (S62-T209)
      Accession # O35565
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FGF10; Produced By Fibroblasts Of Urinary Bladder Lamina Propria; Fibroblast Growth Factor 10; Fibroblast Growth Factor; Keratinocyte Growth Factor 2; LADD3; FGF-10; FGF

  • AA Sequence

    SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT

  • Predicted Molecular Mass

    17 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 800 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Nomura S, et al. FGF10/FGFR2 signal induces cell migration and invasion in pancreatic cancer. Br J Cancer. 2008 Jul 22;99(2):305-13. [Content Brief]

[2]. Bagai S, et al. Fibroblast growth factor-10 is a mitogen for urothelial cells. J Biol Chem. 2002 Jun 28;277(26):23828-37. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 this effect is 7.948 ng/mL, corresponding to a specific activity is 1.2582×105 units/mg.

  • KGF-2/FGF-10 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Mouse
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Mouse
  • KGF-2/FGF-10 Protein, Mouse Product Image