FGFR-3 Protein, Human (Active, K650M, sf9, His-GST)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3, Human (Active, K650M, sf9, His-GST) is the recombinant human-derived FGFR-3 protein, expressed by sf9 insect cells, with N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3, Human (Active, K650M, sf9, His-GST) is the recombinant human-derived FGFR-3 protein, expressed by sf9 insect cells, with N-Avi labeled tag.

Background

FGFR-3 protein, a tyrosine-protein kinase, functions as a cell-surface receptor for fibroblast growth factors, playing a vital role in the regulation of cell proliferation, differentiation, and apoptosis. Its significance is particularly notable in the regulation of chondrocyte differentiation, proliferation, and apoptosis, contributing to normal skeleton development. Additionally, FGFR-3 plays a crucial role in both osteogenesis and postnatal bone mineralization by osteoblasts, while also promoting apoptosis in chondrocytes. Beyond its role in normal development, FGFR-3 is involved in inner ear development and has implications in the regulation of vitamin D metabolism. Upon ligand binding, FGFR-3 activates several signaling cascades, including the phosphorylation of PLCG1, CBL, and FRS2. This activation leads to the production of cellular signaling molecules such as diacylglycerol and inositol 1,4,5-trisphosphate. Furthermore, phosphorylation of FRS2 triggers the recruitment of GRB2, GAB1, PIK3R1, and SOS1, mediating the activation of RAS, MAPK1/ERK2, MAPK3/ERK1, the MAP kinase signaling pathway, and the AKT1 signaling pathway. Mutations leading to constitutive kinase activation or impairing normal FGFR3 maturation, internalization, and degradation result in aberrant signaling. Overexpression or constitutive activation of FGFR3 promotes the activation of PTPN11/SHP2, STAT1, STAT5A, and STAT5B. Additionally, the secreted isoform 3 retains its capacity to bind FGF1 and FGF2, potentially interfering with FGF signaling.

Technical Parameters

  • Species Human
  • Source sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • (P436-T806, K650M)
      Accession # P22607-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FGFR3; Mutant Fibroblast Growth Factor Receptor 3; Prev. ACH; Fibroblast Growth Factor Receptor 3-S; JTK4; Fibroblast Growth Factor Receptor; CD333; Receptor Protein-Tyrosine Kinase; CEK2; Hydroxyaryl-Protein Kinase; FGFR-3; Tyrosine Kinase JTK4; Fibrobla

  • AA Sequence

    PLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKMTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipped with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00