FGL1 Protein, Cynomolgus (HEK293, His)
Fibrinogen like 1 (FGL1) is a proliferation- and metabolism-related protein secreted by the liver. FGL1 is also upregulated in tumor tissues. FGL1 is a checkpoint ligand of lymphocyte activation gene 3 (LAG3). When binding to LAG3, FGL1 can inhibit T cell activation and proliferation. FGL1 can be used for research of immune checkpoint therapy. FGL1 plays a role in proliferation, metabolism, apoptosis, epithelial-to-mesenchymal transition, and immune infiltration. FGL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGL1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Fibrinogen like 1 (FGL1) is a proliferation- and metabolism-related protein secreted by the liver. FGL1 is also upregulated in tumor tissues. FGL1 is a checkpoint ligand of lymphocyte activation gene 3 (LAG3). When binding to LAG3, FGL1 can inhibit T cell activation and proliferation. FGL1 can be used for research of immune checkpoint therapy. FGL1 plays a role in proliferation, metabolism, apoptosis, epithelial-to-mesenchymal transition, and immune infiltration[1][2][3][4]. FGL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGL1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Fibrinogen like 1 (FGL1), also known as HFREP-1 or hepassocin (HPS), is a proliferation- and metabolism-related protein secreted by the liver. FGL1 is a newly emerging checkpoint ligand of lymphocyte activation gene 3 (LAG3). When binding to LAG3, it can inhibit T cell activation and proliferation. Therefore, FGL1 can potentiate anti-tumor T cell responses and can be used for research of immune checkpoint therapy. Apart from the high expression in the liver, FGL1 is also upregulated in tumor tissues (such as lung, prostate, melanoma, colorectal, breast and brain tumors) and mediates EMT process. FGL1 is an approxiamte 68-KD protein comprised of a disulfide bond-linked homodimer[1][2][3].
Besides, as a liver protective factor, FGL1 accelerates the growth of liver cells by promoting mitochondrial mitosis in the event of liver injury. FGL1 plays a role in proliferation, metabolism, apoptosis, epithelial-to-mesenchymal transition, and immune infiltration[3][4].
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-6*His
-
Accession
A0A2K5X990 (L23-I312)
-
Gene ID102118020
-
Molecular Construction
-
N-term
-
FGL1 (L23-I312)
Accession # A0A2K5X990 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGL1; Fibrinogen-Like Protein 1; Fibrinogen Like 1; LFIRE-1; HPS; HFREP1; Hepassocin; HP-041; HFREP-1; Hepatocellular Carcinoma-Related Sequence; Hepatocyte-Derived Fibrinogen-Related Protein 1; LFIRE1; Liver Fibrinogen-Related Protein 1
-
AA Sequence
LEDCAQEQVRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGEENSVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFAVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGSFHPEVQWWATHQRMKFSTWDRDHDNYDGNCAEEDQSGWWFNRCHSANLNGLYYTGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
-
Predicted Molecular Mass
34.8 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
