FITC-Labeled VEGF165 Protein, Human (HEK293, His-Avi, solution)

VEGF165 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. FITC-Labeled VEGF165 Protein, Human (HEK293, C-His) is the recombinant human-derived FITC-Labeled VEGF165 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

VEGF165 is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PGF. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. VEGF-A also binds to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. VEGF165 may be secreted by tumour cells, binds with high affinity to VEGFR-1 and VEGFR-2 receptors^{[1][2][3][4][5][6][7][8]}.

Immobilized FITC-Labeled Human VEGF165, His Tag at 1μg/mL (100μL/well) on the plate. Dose response curve for Anti-VEGF165 Antibody, hFc Tag with the EC₅₀ of ≤6.0 ng/mL determined by ELISA.

Human

HEK293

C-8*His;C-Avi

P15692-4 (A27-R191)

7422

Partial

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Approximately 28-33 kDa under reduced (R) conditions, 45-55 kDa under non reducing (N) conditions, based on SDS-PAGE.

≥ 90%, as determined by Bis-Tris PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, 100 mM L-Arginine (pH 7.4).

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 6 months from date of receipt, protect from light. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.