FOLR1 Protein, Canine (HEK293, His)

FOLR1 is a folic acid receptor that binds to folic acid and reductive folic acid derivatives and promotes the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers. FOLR1 Protein, Canine (HEK293, His) is the recombinant canine-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.

FOLR1 is a member of the folate receptor (FOLR) family, and the FOLR1 protein is a key mediator of folate uptake, binding to folate and reductive folate derivatives and promoting the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 is also important for normal embryonic development and normal cell proliferation. Autoantibodies to FRA have been linked to neurodevelopmental disorders, particularly brain folate deficiency, schizophrenia, and autism spectrum disorders. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers^[1][2][3].

Measured by its binding ability in a functional ELISA. Immobilized FOLR1 at 2 μg/mL can bind Anti-FOLR1 antibody, the ED₅₀ for this effect is 0.9311 ng/mL .

Canine

HEK293

C-6*His

XP_851993.1 (R25-M228)

609612  [NCBI]

Partial

RTELLNVCMDAKHHKEKPSPEDGLHKQCSPWKKNSCCFANTSREAHKDISYLYRFNWNHCGSMTPACKKHFIQDTCLYECSPNLGPWIQEVNQSWRKERILHVPLCKEDCEQWWQDCRTSYTCKSNWHKGWNWTSGYNQCPEGAACHPFHFYFPTSAALCSEIWSHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYARAM

Approximately 27-40 kDa due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.