FOLR1 Protein, Canine (HEK293, His)
Based on 1 Customer Validation
FOLR1 is a folic acid receptor that binds to folic acid and reductive folic acid derivatives and promotes the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers. FOLR1 Protein, Canine (HEK293, His) is the recombinant canine-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FOLR1 is a folic acid receptor that binds to folic acid and reductive folic acid derivatives and promotes the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers. FOLR1 Protein, Canine (HEK293, His) is the recombinant canine-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.
Background
FOLR1 is a member of the folate receptor (FOLR) family, and the FOLR1 protein is a key mediator of folate uptake, binding to folate and reductive folate derivatives and promoting the entry of 5-methyltetrahydrofolate and folate analogs into the cell interior. FOLR1 is also important for normal embryonic development and normal cell proliferation. Autoantibodies to FRA have been linked to neurodevelopmental disorders, particularly brain folate deficiency, schizophrenia, and autism spectrum disorders. FOLR1 enhances the stability and nuclear translocation of β-catenin through the EGFR/AKT/GSK3β axis, thereby promoting the proliferation and migration of laryngeal squamous cell carcinoma (LSCC). FOLR1 is highly expressed in a variety of tumors and is a potential prognostic and therapeutic target for many cancers[1][2][3].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized FOLR1 at 2 μg/mL can bind Anti-FOLR1 antibody, the ED50 for this effect is 0.9311 ng/mL .
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-6*His
-
Accession
XP_851993.1 (R25-M228)
-
Molecular Construction
-
N-term
-
FOLR1 (R25-M228)
Accession # XP_851993.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
FOLR1; KB Cells FBP; Prev. FOLR; FBP; Ovarian Tumor-Associated Antigen MOv18; Folate Binding Protein; Adult Folate-Binding Protein; FRalpha; Folate Receptor 1 (Adult); NCFTD; Folate Receptor, Adult; FRα; Folate Receptor 1; FRA; Folate Receptor Alpha; FR-A
-
AA Sequence
RTELLNVCMDAKHHKEKPSPEDGLHKQCSPWKKNSCCFANTSREAHKDISYLYRFNWNHCGSMTPACKKHFIQDTCLYECSPNLGPWIQEVNQSWRKERILHVPLCKEDCEQWWQDCRTSYTCKSNWHKGWNWTSGYNQCPEGAACHPFHFYFPTSAALCSEIWSHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYARAM
-
Molecular Weight
Approximately 27-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
